From AureoWiki
Jump to navigation Jump to search
Pangenome04-0298108BA0217611819-97685071193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 06-JUL-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2398
  • pan locus tag?: SAUPAN006124000
  • symbol: NWMN_2398
  • pan gene symbol?:
  • synonym:
  • product: C-terminal part of fibronectin binding protein A

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_2398
  • symbol: NWMN_2398
  • product: C-terminal part of fibronectin binding protein A
  • replicon: chromosome
  • strand: -
  • coordinates: 2638828..2639214
  • length: 387
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    GTGCCACCAACGCCACCGACACCAGAAGTACCAAGCGAGCCGGAAACACCAACACCACCG
    ACACCAGAAGTACCAAGCGAGCCGGAAACACCAACACCGCCAACGCCAGAGGTACCAACT
    GAACCTGGTAAACCAATACCACCTGCTAAAGAAGAACCTAAAAAACCTTCTAAACCAGTG
    GAACAAGGTAAAGTAGTAACACCTGTTATTGAAATCAATGAAAAGGTTAAAGCAGTGGTA
    CCAACTAAAAAAGCACAATCTAAGAAATCTGAACTACCTGAAACAGGTGGAGAAGAATCA
    ACAAACAACGGCATGTTGTTCGGCGGATTATTTAGCATTCTAGGTTTAGCATTATTACGC
    AGAAATAAAAAGAATCACAAAGCATAA
    60
    120
    180
    240
    300
    360
    387

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_2398
  • symbol: NWMN_2398
  • description: C-terminal part of fibronectin binding protein A
  • length: 128
  • theoretical pI: 7.54389
  • theoretical MW: 13659.6
  • GRAVY: -0.878125

Function[edit | edit source]

  • TIGRFAM:
    Cell structure Cell envelope Other LPXTG cell wall anchor domain (TIGR01167; HMM-score: 29.9)
    and 1 more
    pullulanase, extracellular (TIGR02102; HMM-score: 13.5)
  • TheSEED:  
    Virulence, Disease and Defense Adhesion Adhesins in Staphylococcus  Fibronectin binding protein FnbB
  • PFAM:
    no clan defined Gram_pos_anchor; LPXTG cell wall anchor motif (PF00746; HMM-score: 38)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cellwall
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 10
    • Extracellular Score: 0
    • Internal Helix: 1
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 0.83
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.184826
    • TAT(Tat/SPI): 0.174121
    • LIPO(Sec/SPII): 0.031849
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MPPTPPTPEVPSEPETPTPPTPEVPSEPETPTPPTPEVPTEPGKPIPPAKEEPKKPSKPVEQGKVVTPVIEINEKVKAVVPTKKAQSKKSELPETGGEESTNNGMLFGGLFSILGLALLRRNKKNHKA

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

  • NWMN_2398 no polycistronic organisation predicted

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]