From AureoWiki
Jump to navigation Jump to search
Pangenome04-0298108BA0217611819-97685071193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS00225 [old locus tag: NWMN_0037 ]
  • pan locus tag?: SAUPAN000670000
  • symbol: NWMN_RS00225
  • pan gene symbol?:
  • synonym:
  • product: LysR family transcriptional regulator

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS00225 [old locus tag: NWMN_0037 ]
  • symbol: NWMN_RS00225
  • product: LysR family transcriptional regulator
  • replicon: chromosome
  • strand: +
  • coordinates: 48312..49055
  • length: 744
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_009641 (48312..49055) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    GTGATTAAATTGAACTTTAATGATTTGGAAATTTTTATAACTGTATGTGAAGAAGCATCT
    ATCAATAAAGCTGCAATTAAACTTAGATATGCACAATCTAATATATCTCAAAGAATTAGC
    AAGCTTGAAAATGAATTAGGTGTAGTTTTGCTTTTTAGAAATCAAAAAGGTGCTAAGGCA
    ACTAAAGCAGGCGAAGAATTCTTAGCGTATAGCAAAAAAGTATTAAGAGATACAGAGACT
    ATAAAAAATAAAATGAAAAATAATACTATGTCTATTTTATGCTCAGAACTGTTATTTAAT
    TATTTATCTGAGAGCGAAGAAATTATGATGTCGAATAACTCAATTAATTTTATTTCTAGT
    GGAAATATTAGAAAAGCTATAGAAAAAAATAATTATGATAAGGTTATTTCATTCATAAAA
    ATTAACGACTCAAATTATAGACTTAGTAATGTTGATACTATGAAAGTAACGCTTTACAGT
    AATGGAAGTAATTATGATAAAGAGGCTTTACTAATAAATAAAGATGAGTTTTGTCCTTTA
    AGGAAAATAACTTTAGATAATAAGCTTGATTCACAACGGGTAATGGAAATTGATTCATTG
    GCAGCAATAATAAACTTAGTTAAACAAGGAAAAGGAAAGGCTTTATTACCTATGACTTTT
    GAGAATAAAAGAGATATAGTACAGGACATTTCTAAGATATTTGAAGTTAACTACTATACT
    TATAATCATATTATGCATCATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    744

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS00225 [old locus tag: NWMN_0037 ]
  • symbol: NWMN_RS00225
  • description: LysR family transcriptional regulator
  • length: 247
  • theoretical pI: 9.18932
  • theoretical MW: 28421.6
  • GRAVY: -0.3417

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Toxin production and resistance transcriptional regulator, ArgP family (TIGR03298; HMM-score: 50.2)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair transcriptional regulator, ArgP family (TIGR03298; HMM-score: 50.2)
    Signal transduction Regulatory functions DNA interactions transcriptional regulator, ArgP family (TIGR03298; HMM-score: 50.2)
    Metabolism Energy metabolism Other pca operon transcription factor PcaQ (TIGR02424; HMM-score: 44.2)
    Signal transduction Regulatory functions DNA interactions pca operon transcription factor PcaQ (TIGR02424; HMM-score: 44.2)
    putative choline sulfate-utilization transcription factor (TIGR03418; HMM-score: 43.2)
    Signal transduction Regulatory functions DNA interactions aminoethylphosphonate catabolism associated LysR family transcriptional regulator (TIGR03339; HMM-score: 41.7)
    and 1 more
    Signal transduction Regulatory functions DNA interactions D-serine deaminase transcriptional activator (TIGR02036; HMM-score: 25.9)
  • TheSEED:
  • PFAM:
    HTH (CL0123) HTH_1; Bacterial regulatory helix-turn-helix protein, lysR family (PF00126; HMM-score: 59.6)
    and 3 more
    PBP (CL0177) LysR_substrate; LysR substrate binding domain (PF03466; HMM-score: 14.9)
    HAD (CL0137) PNK3P; Polynucleotide kinase 3 phosphatase (PF08645; HMM-score: 14.6)
    no clan defined Imm43; Immunity protein 43 (PF15570; HMM-score: 9.6)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002785
    • TAT(Tat/SPI): 0.000739
    • LIPO(Sec/SPII): 0.000506
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_001793250 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MIKLNFNDLEIFITVCEEASINKAAIKLRYAQSNISQRISKLENELGVVLLFRNQKGAKATKAGEEFLAYSKKVLRDTETIKNKMKNNTMSILCSELLFNYLSESEEIMMSNNSINFISSGNIRKAIEKNNYDKVISFIKINDSNYRLSNVDTMKVTLYSNGSNYDKEALLINKDEFCPLRKITLDNKLDSQRVMEIDSLAAIINLVKQGKGKALLPMTFENKRDIVQDISKIFEVNYYTYNHIMHH

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]