Jump to navigation
Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS01470
- pan locus tag?:
- symbol: NWMN_RS01470
- pan gene symbol?: —
- synonym:
- product: transcriptional regulator
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS01470
- symbol: NWMN_RS01470
- product: transcriptional regulator
- replicon: chromosome
- strand: -
- coordinates: 323762..324076
- length: 315
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_009641 (323762..324076) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGTGCTTTTCAAAAAGAATGAAACAATCAAGAGAAAAACAAGGTATGACTTTGGCCGAA
CTAGGAAGAAAAATTGGTAAAACTGAAGCTACTGTACAACGTTATGAAAGCGGAAATATC
AAAAATCTAAAAAACGATACTATAGAAAGTATAGCTACTGCATTAAATGTTAATCCTGCG
TATTTAATGGGGTGGGTTGAAGAAAACGATGATGAAGTACAACATCGTGCAGCTCATTTA
GAAGGAGAATTAACTGATGACGAGTGGCAAAGAGTTTTAGATTATGCAGATTATATAAGA
AGTAAACGTAAGTAA60
120
180
240
300
315
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS01470
- symbol: NWMN_RS01470
- description: transcriptional regulator
- length: 104
- theoretical pI: 6.53233
- theoretical MW: 12063.5
- GRAVY: -0.932692
⊟Function[edit | edit source]
- TIGRFAM: putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 25.3)and 6 moreHypothetical proteins Conserved TIGR00270 family protein (TIGR00270; HMM-score: 16.9)RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 16.2)probable regulatory domain (TIGR03879; HMM-score: 15.8)Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 15.6)Unknown function General mobile mystery protein A (TIGR02612; HMM-score: 14.2)Cellular processes Detoxification cyanase (TIGR00673; EC 4.2.1.104; HMM-score: 13.5)
- TheSEED:
- PFAM: HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 50.1)HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 41)and 14 moreHTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 39.4)HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 32.8)HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 20.4)HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 20.3)HTH_23; Homeodomain-like domain (PF13384; HMM-score: 19.2)Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 16.8)HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 15)Pou; Pou domain - N-terminal to homeobox domain (PF00157; HMM-score: 14.4)HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 13.5)no clan defined GP57; Phage Tail fiber assembly helper protein (PF17594; HMM-score: 13.2)HTH (CL0123) HTH_35; Winged helix-turn-helix DNA-binding (PF13693; HMM-score: 13.1)HTH_AsnC-type; AsnC-type helix-turn-helix domain (PF13404; HMM-score: 12.5)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 12.2)Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 11.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.010862
- TAT(Tat/SPI): 0.00149
- LIPO(Sec/SPII): 0.001722
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MCFSKRMKQSREKQGMTLAELGRKIGKTEATVQRYESGNIKNLKNDTIESIATALNVNPAYLMGWVEENDDEVQHRAAHLEGELTDDEWQRVLDYADYIRSKRK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]