From AureoWiki
Jump to navigation Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS01470
  • pan locus tag?:
  • symbol: NWMN_RS01470
  • pan gene symbol?:
  • synonym:
  • product: transcriptional regulator

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS01470
  • symbol: NWMN_RS01470
  • product: transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 323762..324076
  • length: 315
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_009641 (323762..324076) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGTGCTTTTCAAAAAGAATGAAACAATCAAGAGAAAAACAAGGTATGACTTTGGCCGAA
    CTAGGAAGAAAAATTGGTAAAACTGAAGCTACTGTACAACGTTATGAAAGCGGAAATATC
    AAAAATCTAAAAAACGATACTATAGAAAGTATAGCTACTGCATTAAATGTTAATCCTGCG
    TATTTAATGGGGTGGGTTGAAGAAAACGATGATGAAGTACAACATCGTGCAGCTCATTTA
    GAAGGAGAATTAACTGATGACGAGTGGCAAAGAGTTTTAGATTATGCAGATTATATAAGA
    AGTAAACGTAAGTAA
    60
    120
    180
    240
    300
    315

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS01470
  • symbol: NWMN_RS01470
  • description: transcriptional regulator
  • length: 104
  • theoretical pI: 6.53233
  • theoretical MW: 12063.5
  • GRAVY: -0.932692

Function[edit | edit source]

  • TIGRFAM:
    putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 25.3)
    and 6 more
    Hypothetical proteins Conserved TIGR00270 family protein (TIGR00270; HMM-score: 16.9)
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 16.2)
    probable regulatory domain (TIGR03879; HMM-score: 15.8)
    Signal transduction Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 15.6)
    Unknown function General mobile mystery protein A (TIGR02612; HMM-score: 14.2)
    Cellular processes Cellular processes Detoxification cyanase (TIGR00673; EC 4.2.1.104; HMM-score: 13.5)
  • TheSEED:
  • PFAM:
    HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 50.1)
    HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 41)
    and 14 more
    HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 39.4)
    HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 32.8)
    HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 20.4)
    HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 20.3)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 19.2)
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 16.8)
    HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 15)
    Pou; Pou domain - N-terminal to homeobox domain (PF00157; HMM-score: 14.4)
    HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 13.5)
    no clan defined GP57; Phage Tail fiber assembly helper protein (PF17594; HMM-score: 13.2)
    HTH (CL0123) HTH_35; Winged helix-turn-helix DNA-binding (PF13693; HMM-score: 13.1)
    HTH_AsnC-type; AsnC-type helix-turn-helix domain (PF13404; HMM-score: 12.5)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 12.2)
    Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 11.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.010862
    • TAT(Tat/SPI): 0.00149
    • LIPO(Sec/SPII): 0.001722
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446255775 NCBI
  • RefSeq: WP_000333630 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MCFSKRMKQSREKQGMTLAELGRKIGKTEATVQRYESGNIKNLKNDTIESIATALNVNPAYLMGWVEENDDEVQHRAAHLEGELTDDEWQRVLDYADYIRSKRK

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]