From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS01510 [old locus tag: NWMN_0270 ]
  • pan locus tag?: SAUPAN000160000
  • symbol: NWMN_RS01510
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS01510 [old locus tag: NWMN_0270 ]
  • symbol: NWMN_RS01510
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 326841..327101
  • length: 261
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_009641 (326841..327101) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_0270

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGTATTACGAAATAGGCGAAATCATACGCAAAAATATTCATGTTAACGGATTCGATTTT
    AAGCTATTCATTTTAAAAGGTCATATGGGCATATCAATACAAGTTAAAGATATGAACAAC
    GTACCAATTAAACATGCTTATGTCGTAGATGAGAATGACTTAGATATGGCATCAGACTTA
    TTTAACCAAGCAATAGATGAATGGATTGAAGAGAACACAGACGAACAGGACAGACTAATT
    AACTTAGTCATGAAATGGTAG
    60
    120
    180
    240
    261

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS01510 [old locus tag: NWMN_0270 ]
  • symbol: NWMN_RS01510
  • description: hypothetical protein
  • length: 86
  • theoretical pI: 4.35077
  • theoretical MW: 10186.6
  • GRAVY: -0.280233

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED:
  • PFAM:
    no clan defined DUF1108; Protein of unknown function (DUF1108) (PF06531; HMM-score: 105.3)
    and 1 more
    AB_hydrolase (CL0028) DUF2974; Protein of unknown function (DUF2974) (PF11187; HMM-score: 15.1)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005362
    • TAT(Tat/SPI): 0.000201
    • LIPO(Sec/SPII): 0.000491
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MYYEIGEIIRKNIHVNGFDFKLFILKGHMGISIQVKDMNNVPIKHAYVVDENDLDMASDLFNQAIDEWIEENTDEQDRLINLVMKW

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]