Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS01755 [old locus tag: NWMN_0308 ]
- pan locus tag?: SAUPAN000622000
- symbol: NWMN_RS01755
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS01755 [old locus tag: NWMN_0308 ]
- symbol: NWMN_RS01755
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 357446..357745
- length: 300
- essential: unknown
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGTTTGGATTTACCAAACGACATGAACAAGATTGGCGTTTAACGCGATTAGAAGAAAAT
GATAAGACTATGTTTGAAAAATTCGACAGAATAGAAGATAGTCTTAGAGCGCAAGAAAAG
ATTTATGACAAATTAGATAGAAATTTTGAAGAATTAAAGCGCGACAAGGTAGAAGATGAA
AAGAATAAAGAAAAGAATGCCAAGAATATTAGAGACATAAAAATGTGGATTCTAGGTTTG
ATAGGGACTATCTTCAGTACGATTGTCATAGCTTTACTAAGAACTGTTTTTGGTATTTAA60
120
180
240
300
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS01755 [old locus tag: NWMN_0308 ]
- symbol: NWMN_RS01755
- description: hypothetical protein
- length: 99
- theoretical pI: 9.02274
- theoretical MW: 12010.8
- GRAVY: -0.737374
⊟Function[edit | edit source]
- TIGRFAM: DNA metabolism Other MutS2 family protein (TIGR01069; HMM-score: 8.5)
- TheSEED: see NWMN_0308
- PFAM: no clan defined DUF2951; Protein of unknown function (DUF2951) (PF11166; HMM-score: 178.4)and 10 moreXhlA; Haemolysin XhlA (PF10779; HMM-score: 19.9)MpPF26; M penetrans paralogue family 26 (PF07666; HMM-score: 17.4)TUNAR; TUNAR (PF21954; HMM-score: 15.6)TPR (CL0020) Sec3_C_2; Sec3 exocyst complex subunit (PF15278; HMM-score: 14.7)no clan defined TelA; Toxic anion resistance protein (TelA) (PF05816; HMM-score: 14.3)DUF2207_C; Predicted membrane protein (DUF2207) C-terminal domain (PF20990; HMM-score: 13.6)YxiF; YxiF protein (PF24715; HMM-score: 13.6)Cyclin (CL0065) DUF3452; Domain of unknown function (DUF3452) (PF11934; HMM-score: 13.4)no clan defined DRAT; Dinitrogenase reductase ADP-ribosyltransferase (DRAT) (PF07357; HMM-score: 11.5)PBDC1; PBDC1 protein (PF04669; HMM-score: 11.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.78
- Cytoplasmic Membrane Score: 8.16
- Cellwall Score: 0.06
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0212
- Cytoplasmic Membrane Score: 0.8518
- Cell wall & surface Score: 0.0017
- Extracellular Score: 0.1254
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002331
- TAT(Tat/SPI): 0.000943
- LIPO(Sec/SPII): 0.00094
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MFGFTKRHEQDWRLTRLEENDKTMFEKFDRIEDSLRAQEKIYDKLDRNFEELKRDKVEDEKNKEKNAKNIRDIKMWILGLIGTIFSTIVIALLRTVFGI
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]