Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS02685 [old locus tag: NWMN_0469 ]
- pan locus tag?: SAUPAN002248000
- symbol: NWMN_RS02685
- pan gene symbol?: divIC
- synonym:
- product: cell division protein DIVIC
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS02685 [old locus tag: NWMN_0469 ]
- symbol: NWMN_RS02685
- product: cell division protein DIVIC
- replicon: chromosome
- strand: +
- coordinates: 534163..534555
- length: 393
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGAAAAATAAAGTAGAACATATAGAAAATCAGTACACGTCGCAAGAGAACAAGAAAAAA
CAACGTCAAAAAATGAAAATGCGTGTTGTTCGTAGGCGTATTACAGTATTTGCGGGCGTA
TTACTTGCGATAATTGTTGTTTTATCAATCTTGCTTGTTGTCCAAAAACATCGCAATGAT
ATTGATGCACAGGAGCGAAAAGCGAAAGAAGCACAGTTTCAAAAGCAACAAAATGAAGAA
ATTGCGTTAAAAGAAAAGTTGAATAATCTGAATGACAAAGATTACATTGAAAAAATTGCG
CGTGATGATTATTACTTAAGCAACAAAGGTGAAGTGATTTTTAGGTTGCCAGAAGACAAA
GATTCGTCTAGCTCAAAATCTTCGAAAAAATAA60
120
180
240
300
360
393
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS02685 [old locus tag: NWMN_0469 ]
- symbol: NWMN_RS02685
- description: cell division protein DIVIC
- length: 130
- theoretical pI: 10.4495
- theoretical MW: 15347.6
- GRAVY: -0.941538
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Cell division cell division protein FtsL (TIGR02209; HMM-score: 22)and 4 morecytochrome c oxidase accessory protein CcoG (TIGR02745; HMM-score: 16.6)TIGR03943 family protein (TIGR03943; HMM-score: 13.3)Protein fate Protein folding and stabilization cytochrome c-type biogenesis protein CcmI (TIGR03142; HMM-score: 12.5)Energy metabolism Electron transport cytochrome c-type biogenesis protein CcmI (TIGR03142; HMM-score: 12.5)
- TheSEED: see NWMN_0469
- PFAM: FtsL (CL0225) DivIC; Septum formation initiator (PF04977; HMM-score: 68.6)and 15 moreTRAP (CL0757) SIT; SHP2-interacting transmembrane adaptor protein, SIT (PF15330; HMM-score: 16.3)TPR (CL0020) DUF6377; Domain of unknown function (DUF6377) (PF19904; HMM-score: 15.9)no clan defined Gemini_AL2; Geminivirus AL2 protein (PF01440; HMM-score: 15.5)DUF5305; Family of unknown function (DUF5305) (PF17231; HMM-score: 14.9)TRAP_alpha; Translocon-associated protein (TRAP), alpha subunit (PF03896; HMM-score: 13.9)EphA2_TM; Ephrin type-A receptor 2 transmembrane domain (PF14575; HMM-score: 13.5)INSIG-like (CL0798) INSIG; Insulin-induced protein (INSIG) (PF07281; HMM-score: 12.3)HTH (CL0123) WH_AprA; AprA winged helix domain (PF23589; HMM-score: 12.2)no clan defined LapA_dom; Lipopolysaccharide assembly protein A domain (PF06305; HMM-score: 12.1)MASE10; MASE10 (PF20970; HMM-score: 12.1)GPCR_A (CL0192) Frizzled; Frizzled/Smoothened family membrane region (PF01534; HMM-score: 10.5)Omega_toxin (CL0083) Conotoxin; Conotoxin (PF02950; HMM-score: 10.5)YhhM-like (CL0851) DUF2500; Protein of unknown function (DUF2500) (PF10694; HMM-score: 9.4)no clan defined Baculo_11_kDa; Baculovirus 11 kDa family (PF06143; HMM-score: 8.3)UPF0239; Uncharacterised protein family (UPF0239) (PF06783; HMM-score: 7.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cellwall
- Cytoplasmic Score: 0.01
- Cytoplasmic Membrane Score: 0.53
- Cellwall Score: 8.75
- Extracellular Score: 0.7
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.998
- Cell wall & surface Score: 0
- Extracellular Score: 0.002
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.017308
- TAT(Tat/SPI): 0.000593
- LIPO(Sec/SPII): 0.005031
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKNKVEHIENQYTSQENKKKQRQKMKMRVVRRRITVFAGVLLAIIVVLSILLVVQKHRNDIDAQERKAKEAQFQKQQNEEIALKEKLNNLNDKDYIEKIARDDYYLSNKGEVIFRLPEDKDSSSSKSSKK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]