Jump to navigation
Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS03870
- pan locus tag?:
- symbol: NWMN_RS03870
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS03870
- symbol: NWMN_RS03870
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 765113..765319
- length: 207
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_009641 (765113..765319) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGATTATTGTTTATATTGTGCTGTTGTTAATTCTTGTATACGTAAATTATCGATTAGTG
AATCGATTGCTATCTGAAAATAGAATATATGTTGTTCGTTTGATAGCAACAATTACTACT
GTTATAAGCTTTATCCTTGTATACGCATTAATTCACGAACTTATGCCTTTTGTTGTGCGG
GCAATGGATTTAATGTACCACCAGTAA60
120
180
207
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS03870
- symbol: NWMN_RS03870
- description: hypothetical protein
- length: 68
- theoretical pI: 9.46024
- theoretical MW: 8082.92
- GRAVY: 1.30735
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM: GT-C (CL0111) PMT_2; Dolichyl-phosphate-mannose-protein mannosyltransferase (PF13231; HMM-score: 10)Peptidase_MA (CL0126) Peptidase_M56; BlaR1 peptidase M56 (PF05569; HMM-score: 9.8)CPA_AT (CL0064) DUF819; Protein of unknown function (DUF819) (PF05684; HMM-score: 9.3)and 1 moreno clan defined DUF4750; Domain of unknown function (DUF4750) (PF15938; HMM-score: 6.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9994
- Cell wall & surface Score: 0
- Extracellular Score: 0.0005
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00324
- TAT(Tat/SPI): 0.000079
- LIPO(Sec/SPII): 0.002288
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIIVYIVLLLILVYVNYRLVNRLLSENRIYVVRLIATITTVISFILVYALIHELMPFVVRAMDLMYHQ
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.