From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS04230 [old locus tag: NWMN_0748 ]
  • pan locus tag?: SAUPAN002713000
  • symbol: NWMN_RS04230
  • pan gene symbol?: est
  • synonym:
  • product: carboxylesterase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS04230 [old locus tag: NWMN_0748 ]
  • symbol: NWMN_RS04230
  • product: carboxylesterase
  • replicon: chromosome
  • strand: +
  • coordinates: 841346..842086
  • length: 741
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_009641 (841346..842086) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGCAGATAAAATTACCAAAACCTTTCTTTTTTGAGGAAGGTAAACGTGCCGTGTTATTA
    CTACATGGTTTTACAGGCAATTCGTCTGATGTTCGTCAATTAGGTCGATTTTTACAAAAG
    AAAGGTTATACATCATATGCACCGCAATATGAAGGCCACGCGGCACCACCAGATGAAATA
    CTGAAATCTAGTCCTTTCGTTTGGTTTAAAGATGCGTTAGATGGTTATGATTATCTTGTT
    GAACAAGGTTATGATGAAATTGTTGTTGCTGGTCTATCATTAGGTGGGGATTTTGCTTTA
    AAATTAAGCTTAAATAGAGATGTAAAGGGTATTGTAACGATGTGTGCTCCTATGGGTGGC
    AAAACTGAAGGTGCCATTTATGAAGGCTTTTTAGAATATGCACGCAATTTTAAAAAGTAT
    GAAGGTAAAGATCAAGAGACTATTGATAATGAAATGGATCATTTTAAACCAACTGAAACT
    TTAAAAGAACTAAGTGAAGCATTAGATACGATTAAAGAGCAAGTTGATGAAGTGTTGGAT
    CCTATTTTAGTGATTCAAGCAGAAAACGACAATATGATTGATCCACAATCCGCAAATTAT
    ATATATGACCATGTAGATTCTGATGACAAAAATATCAAGTGGTACAGTGAATCTGGACAT
    GTTATTACGATTGATAAAGAGAAAGAACAAGTATTTGAAGATATTTATCAATTTTTAGAG
    TCATTAGACTGGTCAGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    741

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS04230 [old locus tag: NWMN_0748 ]
  • symbol: NWMN_RS04230
  • description: carboxylesterase
  • length: 246
  • theoretical pI: 4.25813
  • theoretical MW: 28094.2
  • GRAVY: -0.512602

Function[edit | edit source]

  • TIGRFAM:
    Plasmodium subtelomeric family (TIGR01607; HMM-score: 29.2)
    Metabolism Fatty acid and phospholipid metabolism Biosynthesis poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit (TIGR01836; HMM-score: 25.1)
    and 3 more
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (TIGR03695; EC 4.2.99.20; HMM-score: 22.3)
    Metabolism Energy metabolism Other 3-oxoadipate enol-lactonase (TIGR02427; EC 3.1.1.24; HMM-score: 20.3)
    Metabolism Energy metabolism Photosynthesis putative magnesium chelatase accessory protein (TIGR03056; HMM-score: 11)
  • TheSEED:
  • PFAM:
    AB_hydrolase (CL0028) Hydrolase_4; Serine aminopeptidase, S33 (PF12146; HMM-score: 69.8)
    and 13 more
    Abhydrolase_1; alpha/beta hydrolase fold (PF00561; HMM-score: 37.5)
    DLH; Dienelactone hydrolase family (PF01738; HMM-score: 35.9)
    Peptidase_S9; Prolyl oligopeptidase family (PF00326; HMM-score: 30.3)
    Abhydrolase_6; Alpha/beta hydrolase family (PF12697; HMM-score: 25.3)
    BAAT_C; BAAT / Acyl-CoA thioester hydrolase C terminal (PF08840; HMM-score: 22.8)
    Abhydrolase_3; alpha/beta hydrolase fold (PF07859; HMM-score: 19.2)
    DUF2048; Abhydrolase domain containing 18 (PF09752; HMM-score: 18.2)
    PhoPQ_related; PhoPQ-activated pathogenicity-related protein (PF10142; HMM-score: 17.7)
    FSH1; Serine hydrolase (FSH1) (PF03959; HMM-score: 16.4)
    no clan defined DUF4611; Domain of unknown function (DUF4611) (PF15387; HMM-score: 15.5)
    LisH (CL0561) LisH; LisH (PF08513; HMM-score: 14.4)
    AB_hydrolase (CL0028) Chlorophyllase2; Chlorophyllase enzyme (PF12740; HMM-score: 13.8)
    Chlorophyllase; Chlorophyllase (PF07224; HMM-score: 12.5)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.014415
    • TAT(Tat/SPI): 0.008541
    • LIPO(Sec/SPII): 0.004087
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 447088696 NCBI
  • RefSeq: WP_001165952 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MQIKLPKPFFFEEGKRAVLLLHGFTGNSSDVRQLGRFLQKKGYTSYAPQYEGHAAPPDEILKSSPFVWFKDALDGYDYLVEQGYDEIVVAGLSLGGDFALKLSLNRDVKGIVTMCAPMGGKTEGAIYEGFLEYARNFKKYEGKDQETIDNEMDHFKPTETLKELSEALDTIKEQVDEVLDPILVIQAENDNMIDPQSANYIYDHVDSDDKNIKWYSESGHVITIDKEKEQVFEDIYQFLESLDWSE

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]