Jump to navigation
Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS05585
- pan locus tag?:
- symbol: NWMN_RS05585
- pan gene symbol?: —
- synonym:
- product: transcriptional regulator
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS05585
- symbol: NWMN_RS05585
- product: transcriptional regulator
- replicon: chromosome
- strand: +
- coordinates: 1102380..1102598
- length: 219
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_009641 (1102380..1102598) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGCAATGGAATTTAATAAAGTTGAGAAAAGAAAGAAAGTGTACTCAAGAAGATTTAGCA
AACCTCTTGAATATATCAACTGAAGGTTATCGTTTAAAGGAATTAGGAAAGCATCAATTT
AAGAATGATGAGATGTTTATTATCGCTGATTTTTTTGACGAAAATATTGGAGATATTTTT
TTACCCACAAAGTACACGAAACGCAAACAAACATCTTAA60
120
180
219
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS05585
- symbol: NWMN_RS05585
- description: transcriptional regulator
- length: 72
- theoretical pI: 9.15277
- theoretical MW: 8654.91
- GRAVY: -0.783333
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 17.6)
- TheSEED:
- PFAM: HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 23.8)and 5 moreHTH_19; Helix-turn-helix domain (PF12844; HMM-score: 18.7)Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 16.7)HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 14.8)HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 13.8)HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 12)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002068
- TAT(Tat/SPI): 0.000169
- LIPO(Sec/SPII): 0.000518
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MQWNLIKLRKERKCTQEDLANLLNISTEGYRLKELGKHQFKNDEMFIIADFFDENIGDIFLPTKYTKRKQTS
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.