From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS05685 [old locus tag: NWMN_1008 ]
  • pan locus tag?: SAUPAN001390000
  • symbol: NWMN_RS05685
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS05685 [old locus tag: NWMN_1008 ]
  • symbol: NWMN_RS05685
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1111781..1112029
  • length: 249
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_009641 (1111781..1112029) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_1008

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGACCATGACAGATAACGCGCGTAAAGAATACTTAAACCAATTTTTCGGCTCTAAGAGA
    TATCTGTATCAGGATAACGAGCGAGTGGCACATATCCATGTAGTGAATGGCGCTTATTAC
    TTTCACGGGCATATCGTACCAGATTGGCAAGGTGTGAAAAAGACATTTGATACAGCGGAA
    GAGCTCGGAATATATATAAAGCAACATGGTTTGGAATACGAGGAACAGAAGCAACTAACT
    TTATTTTAG
    60
    120
    180
    240
    249


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS05685 [old locus tag: NWMN_1008 ]
  • symbol: NWMN_RS05685
  • description: hypothetical protein
  • length: 82
  • theoretical pI: 6.67996
  • theoretical MW: 9800.93
  • GRAVY: -0.706098

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see NWMN_1008
  • PFAM:
    no clan defined Phage_Orf51; Phage Conserved Open Reading Frame 51 (PF06194; HMM-score: 181.2)
    and 1 more
    Peptidase_CA (CL0125) Guanylate_cyc_2; Guanylylate cyclase (PF09778; HMM-score: 12.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9768
    • Cytoplasmic Membrane Score: 0.0055
    • Cell wall & surface Score: 0.0004
    • Extracellular Score: 0.0173
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005272
    • TAT(Tat/SPI): 0.000211
    • LIPO(Sec/SPII): 0.000393
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MTMTDNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGAYYFHGHIVPDWQGVKKTFDTAEELGIYIKQHGLEYEEQKQLTLF

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]