From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS05705 [old locus tag: NWMN_1011 ]
  • pan locus tag?: SAUPAN001388000
  • symbol: NWMN_RS05705
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS05705 [old locus tag: NWMN_1011 ]
  • symbol: NWMN_RS05705
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1113079..1113363
  • length: 285
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_009641 (1113079..1113363) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_1011

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAACTATGAAACAGGGGTCCAACTAGGTGTAATGGACGCTAGGTTGAAGAAGATGAGA
    AAACAACGTGATGAGTACAAGAAGCAACGTGATGAGCTTATTGGGGATATAGGTAAGTTA
    AGAGAACGCAACAAAGAGCTGGAGAAGAAAGCAAGTGCATGGGATAGGTATTGCAAGAGC
    GTTGAAAAAGATTTAATAAACGAATTTGGCAAAGATGGTGAAAGAGTTAAATTTGGAATG
    GAATTAAACAATAAAACTTTTATGGAGGAAGACACTAATGAATAA
    60
    120
    180
    240
    285

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS05705 [old locus tag: NWMN_1011 ]
  • symbol: NWMN_RS05705
  • description: hypothetical protein
  • length: 94
  • theoretical pI: 8.4404
  • theoretical MW: 11224.7
  • GRAVY: -1.32128

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED:
  • PFAM:
    no clan defined BLOC1_2; Biogenesis of lysosome-related organelles complex-1 subunit 2 (PF10046; HMM-score: 20.4)
    Phage_GP20; Phage minor structural protein GP20 (PF06810; HMM-score: 17.1)
    and 6 more
    IncA; IncA protein (PF04156; HMM-score: 14.9)
    Cep57_CLD_2; Centrosome localisation domain of PPC89 (PF14197; HMM-score: 14.8)
    Ax_dynein_light; Axonemal dynein light chain (PF10211; HMM-score: 14.3)
    TMF_DNA_bd; TATA element modulatory factor 1 DNA binding (PF12329; HMM-score: 13.2)
    FtsL (CL0225) DivIC; Septum formation initiator (PF04977; HMM-score: 12.8)
    no clan defined PP28; Casein kinase substrate phosphoprotein PP28 (PF10252; HMM-score: 12.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.007595
    • TAT(Tat/SPI): 0.000686
    • LIPO(Sec/SPII): 0.002287
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MNYETGVQLGVMDARLKKMRKQRDEYKKQRDELIGDIGKLRERNKELEKKASAWDRYCKSVEKDLINEFGKDGERVKFGMELNNKTFMEEDTNE

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]