From AureoWiki
Jump to navigation Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS06635
  • pan locus tag?:
  • symbol: NWMN_RS06635
  • pan gene symbol?:
  • synonym:
  • product: DNA-binding protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS06635
  • symbol: NWMN_RS06635
  • product: DNA-binding protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1295765..1296049
  • length: 285
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_009641 (1295765..1296049) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAAAAAGAAAAAAATTCCGATGCGAAAATGTATTCTTTCAAATGAAATGCATCCCAAA
    AAAGATATGATTCGTGTTGTTGTTAATAAAGAAGGCGAAATCTTTGCGGATGTTACTGGA
    AAGAAACAAGGCCGTGGCGCATATGTTTCTAAAGATGTTGCTATGGTTGAAAAAGCACAA
    CAAAAAGAAATTTTAGAAAAATATTTTAAAGCATCTAAAGAGCAATTGGATCCTGTTTAC
    AAAGAAATTATTAGATTAATTTATAGAGAAGAGATCCCAAAATGA
    60
    120
    180
    240
    285

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS06635
  • symbol: NWMN_RS06635
  • description: DNA-binding protein
  • length: 94
  • theoretical pI: 10.3227
  • theoretical MW: 11040.1
  • GRAVY: -0.705319

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED:
  • PFAM:
    no clan defined YlxR; Protein of unknown function (DUF448) (PF04296; HMM-score: 90.6)
    and 5 more
    CdiI_2; CdiI immunity protein (PF18593; HMM-score: 14)
    DUF3294; Protein of unknown function (DUF3294) (PF07957; HMM-score: 13.4)
    ACDC; AP2-coincident C-terminal (PF14733; HMM-score: 13.3)
    NTF2 (CL0051) DUF6715; Domain of unknown function (DUF6715) (PF20462; HMM-score: 13.3)
    Apolipoprotein (CL0725) ApoA-II; Apolipoprotein A-II (ApoA-II) (PF04711; HMM-score: 13.1)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9904
    • Cytoplasmic Membrane Score: 0.0006
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0089
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.010768
    • TAT(Tat/SPI): 0.000449
    • LIPO(Sec/SPII): 0.001392
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446650077 NCBI
  • RefSeq: WP_000727423 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MKKKKIPMRKCILSNEMHPKKDMIRVVVNKEGEIFADVTGKKQGRGAYVSKDVAMVEKAQQKEILEKYFKASKEQLDPVYKEIIRLIYREEIPK

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]