From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS07525 [old locus tag: NWMN_1335 ]
  • pan locus tag?: SAUPAN003856000
  • symbol: NWMN_RS07525
  • pan gene symbol?: msrA1
  • synonym:
  • product: peptide-methionine (S)-S-oxide reductase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS07525 [old locus tag: NWMN_1335 ]
  • symbol: NWMN_RS07525
  • product: peptide-methionine (S)-S-oxide reductase
  • replicon: chromosome
  • strand: -
  • coordinates: 1468493..1469026
  • length: 534
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_009641 (1468493..1469026) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGACAAAAGAATATGCAACATTAGCAGGAGGATGTTTCTGGTGCATGGTTAAACCATTT
    ACATCATATCCAGGCATCAAGTCAGTCGTATCTGGTTATAGTGGCGGTCATGTTGACAAC
    CCAACTTATGAACAGGTATGTACGAATCAAACCGGCCATGTCGAAGCAGTACAAATTACG
    TTTGATCCAGAGGTTACTTCCTTTGAAAATATATTAGACATATATTTCAAAACATTTGAC
    CCAACTGATGATCAAGGGCAATTTTTCGATAGAGGCGAAAGCTATCAACCAGTCATTTTC
    TATCATGATGAACATCAGAAAAAGGCTGCTGAGTTTAAAAAGCAACAATTAAATGAACAA
    GGTATTTTCAAGAAACCAGTGATTACACCTATTAAACCATATAAAAATTTCTATCCAGCT
    GAAGACTACCATCAAGATTATTACAAAAAGAACCCGGTACATTATTACCAATATCAACGT
    GGTTCAGGTAGAAAAGCGTTTATAGAATCACATTGGGGGAATCAAAATGCTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    534

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS07525 [old locus tag: NWMN_1335 ]
  • symbol: NWMN_RS07525
  • description: peptide-methionine (S)-S-oxide reductase
  • length: 177
  • theoretical pI: 6.62407
  • theoretical MW: 20587.7
  • GRAVY: -0.807345

Function[edit | edit source]

  • reaction:
    EC 1.8.4.11?  ExPASy
    Peptide-methionine (S)-S-oxide reductase Peptide-L-methionine + thioredoxin disulfide + H2O = peptide-L-methionine (S)-S-oxide + thioredoxin L-methionine + thioredoxin disulfide + H2O = L-methionine (S)-S-oxide + thioredoxin
  • TIGRFAM:
    Cellular processes Cellular processes Adaptations to atypical conditions peptide-methionine (S)-S-oxide reductase (TIGR00401; EC 1.8.4.11; HMM-score: 198.4)
    Genetic information processing Protein fate Protein modification and repair peptide-methionine (S)-S-oxide reductase (TIGR00401; EC 1.8.4.11; HMM-score: 198.4)
  • TheSEED:
  • PFAM:
    no clan defined PMSR; Peptide methionine sulfoxide reductase (PF01625; HMM-score: 197.7)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.219692
    • TAT(Tat/SPI): 0.003703
    • LIPO(Sec/SPII): 0.027135
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446082047 NCBI
  • RefSeq: WP_000159902 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MTKEYATLAGGCFWCMVKPFTSYPGIKSVVSGYSGGHVDNPTYEQVCTNQTGHVEAVQITFDPEVTSFENILDIYFKTFDPTDDQGQFFDRGESYQPVIFYHDEHQKKAAEFKKQQLNEQGIFKKPVITPIKPYKNFYPAEDYHQDYYKKNPVHYYQYQRGSGRKAFIESHWGNQNA

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]