From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS07635 [old locus tag: NWMN_1353 ]
  • pan locus tag?: SAUPAN003899000
  • symbol: NWMN_RS07635
  • pan gene symbol?:
  • synonym:
  • product: DUF4889 domain-containing protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS07635 [old locus tag: NWMN_1353 ]
  • symbol: NWMN_RS07635
  • product: DUF4889 domain-containing protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1519758..1520090
  • length: 333
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_009641 (1519758..1520090) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGGGTAAAAAAATGGGTCTAGGTTTATCTATTGCATTGGTTGTTATTGGTATTGCCGTT
    GTATGTTTAATGATTTTTTCTAGTCAAAAAACGACTTATTTTGGTTATATGAATAGTAAT
    ACAAATGCAGAAAAAGTTGTCAGTGAAAAAGATGGATTAGTCAAACATAATATCAAAGTA
    GAACCATCTAATGATTTCAAGCCGAAAAAAGGAGGCTTTGTAAAATTAGTTTCTAAAGAT
    GATGGGAAGACATTTTATAAACAAGAGATTGTTAAACATGATGACGTCCCACACGGTTTA
    ATGATGAAAATTCACGACATGCATATGAATTAA
    60
    120
    180
    240
    300
    333

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS07635 [old locus tag: NWMN_1353 ]
  • symbol: NWMN_RS07635
  • description: DUF4889 domain-containing protein
  • length: 110
  • theoretical pI: 9.9248
  • theoretical MW: 12258.4
  • GRAVY: -0.185455

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED:
  • PFAM:
    no clan defined DUF4889; Domain of unknown function (DUF4889) (PF16230; HMM-score: 122.4)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • LocateP:
  • SignalP: Signal peptide LIPO(Sec/SPII) length 21 aa
    • SP(Sec/SPI): 0.337021
    • TAT(Tat/SPI): 0.00133
    • LIPO(Sec/SPII): 0.351467
    • Cleavage Site: CS pos: 21-22. AVV-CL. Pr: 0.2415
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

  • GI: 446438947 NCBI
  • RefSeq: WP_000516802 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MGKKMGLGLSIALVVIGIAVVCLMIFSSQKTTYFGYMNSNTNAEKVVSEKDGLVKHNIKVEPSNDFKPKKGGFVKLVSKDDGKTFYKQEIVKHDDVPHGLMMKIHDMHMN

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]