From AureoWiki
Jump to navigation Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS10405
  • pan locus tag?:
  • symbol: NWMN_RS10405
  • pan gene symbol?:
  • synonym:
  • product: transcriptional regulator

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS10405
  • symbol: NWMN_RS10405
  • product: transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 2019808..2020041
  • length: 234
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_009641 (2019808..2020041) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    TTGAAATTAGATGAATGGCGAAAACGAAAAGGTTACACCCAGTCATCTTTCGCAGAAAAA
    CTTGGCATTTCACCGTCTACTTATAACATTTGGGAAAACAACCCAGAAATGATTAAACCT
    AGAGATGCTTTTAGAATTGCTAAGACATTAGATATCTCTATTGATGAGATTATTTTTTTA
    AAAGATGAATCGTATTTTAAATACGTTTTAGTCGAAGAAAAACAAACATCTTAA
    60
    120
    180
    234

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS10405
  • symbol: NWMN_RS10405
  • description: transcriptional regulator
  • length: 77
  • theoretical pI: 6.84599
  • theoretical MW: 9181.42
  • GRAVY: -0.692208

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 15.4)
    putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 13.9)
  • TheSEED:
  • PFAM:
    HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 55)
    and 13 more
    HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 38.7)
    HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 28.7)
    HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 24.7)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 17.2)
    HTH_Tnp_1_2; Helix-turn-helix of insertion element transposase (PF13022; HMM-score: 15.2)
    Phage_CI_repr; Bacteriophage CI repressor helix-turn-helix domain (PF07022; HMM-score: 14.6)
    HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 14.2)
    HTH_8; Bacterial regulatory protein, Fis family (PF02954; HMM-score: 14.1)
    HTH_10; HTH DNA binding domain (PF04967; HMM-score: 13.3)
    HTH_Tnp_1; Transposase (PF01527; HMM-score: 13.2)
    no clan defined Xre-MbcA-ParS_M; Antitoxin Xre/MbcA/ParS-like, middle domain (PF23125; HMM-score: 13)
    WY-like (CL0807) WYL_3; WYL domain (PF18488; HMM-score: 12.7)
    HTH (CL0123) HTH_35; Winged helix-turn-helix DNA-binding (PF13693; HMM-score: 12.4)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8905
    • Cytoplasmic Membrane Score: 0.0135
    • Cell wall & surface Score: 0.0056
    • Extracellular Score: 0.0903
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005723
    • TAT(Tat/SPI): 0.000254
    • LIPO(Sec/SPII): 0.001157
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446685107 NCBI
  • RefSeq: WP_000762453 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MKLDEWRKRKGYTQSSFAEKLGISPSTYNIWENNPEMIKPRDAFRIAKTLDISIDEIIFLKDESYFKYVLVEEKQTS

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]