Jump to navigation
Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS11205
- pan locus tag?:
- symbol: NWMN_RS11205
- pan gene symbol?: —
- synonym:
- product: delta-hemolysin
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS11205
- symbol: NWMN_RS11205
- product: delta-hemolysin
- replicon: chromosome
- strand: -
- coordinates: 2151151..2151285
- length: 135
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_009641 (2151151..2151285) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGAGTTGTTTAATTTTAAGAATTTTTATCTTAATTAAGGAAGGAGTGATTTCAATGGCA
CAAGATATCATTTCAACAATCGGTGACTTAGTAAAATGGATTATCGACACAGTGAACAAA
TTCACTAAAAAATAA60
120
135
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS11205
- symbol: NWMN_RS11205
- description: delta-hemolysin
- length: 44
- theoretical pI: 9.46068
- theoretical MW: 5009.12
- GRAVY: 0.802273
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM: no clan defined Delta_lysin; Delta lysin family (PF05372; HMM-score: 71.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.098909
- TAT(Tat/SPI): 0.001539
- LIPO(Sec/SPII): 0.021637
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSCLILRIFILIKEGVISMAQDIISTIGDLVKWIIDTVNKFTKK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: AgrA (activation) regulon
AgrA (TF) important in Virulence, Quorum sensing; compare RegPrecise for N315
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.