COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

⊟Summary

• organism: Staphylococcus aureus Newman
• locus tag: NWMN_RS13570
• pan locus tag^?:
• symbol: NWMN_RS13570
• pan gene symbol^?: —
• synonym:
• product: Txe/YoeB family addiction module toxin

⊟Genome View

⊟Gene

⊟General

• type: CDS
• locus tag: NWMN_RS13570
• symbol: NWMN_RS13570
• product: Txe/YoeB family addiction module toxin
• replicon: chromosome
• strand: -
• coordinates: 2591865..2592131
• length: 267
• essential: unknown

⊟Accession numbers

• Location: NC_009641 (2591865..2592131) NCBI
• BioCyc:
• MicrobesOnline:

⊟Phenotype

Share your knowledge and add information here. [edit]

⊟DNA sequence

• 1
  61
  121
  181
  241
  
  ATGAGCAATTACACGGTTAAGATTAAAAATTCAGCGAAATCAGATTTAAAGAAAATAAAA
  CATTCTTATTTAAAGAAGTCATTTTTAGAAATTGTTGAGACTTTAAAAAATGATCCGTAT
  AAAATAACACAATCTTTTGAAAAATTAGAGCCTAAATATTTAGAGCGATATTCAAGAAGA
  ATTAACCATCAGCACAGGGTCGTCTATACCGTAGATGATCGAAATAAAGAAGTATTAATA
  CTATCGGCATGGTCACATTATGATTAA
  60
  120
  180
  240
  267
  

⊟Protein

⊟General

• locus tag: NWMN_RS13570
• symbol: NWMN_RS13570
• description: Txe/YoeB family addiction module toxin
• length: 88
• theoretical pI: 10.1415
• theoretical MW: 10648.1
• GRAVY: -0.892045

⊟Function

• TIGRFAM:
  Cellular processes Cellular processes Toxin production and resistance addiction module toxin, Txe/YoeB family (TIGR02116; HMM-score: 99.4)
  Genetic information processing Mobile and extrachromosomal element functions Other addiction module toxin, Txe/YoeB family (TIGR02116; HMM-score: 99.4)
  and 2 more
  Cellular processes Cellular processes Toxin production and resistance addiction module toxin, RelE/StbE family (TIGR02385; HMM-score: 21.2)
  Genetic information processing Mobile and extrachromosomal element functions Other addiction module toxin, RelE/StbE family (TIGR02385; HMM-score: 21.2)
• TheSEED:
• PFAM:
  Plasmid_toxin (CL0136) YoeB_toxin; YoeB-like toxin of bacterial type II toxin-antitoxin system (PF06769; HMM-score: 38.3)
  and 6 more
  ParE_toxin; ParE toxin of type II toxin-antitoxin system, parDE (PF05016; HMM-score: 30.6)
  HigB-like_toxin; RelE-like toxin of type II toxin-antitoxin system HigB (PF05015; HMM-score: 19.5)
  no clan defined TINF2_N; TERF1-interacting nuclear factor 2 N-terminus (PF14973; HMM-score: 17.4)
  Met_repress (CL0057) VAPB_antitox; Putative antitoxin (PF02697; HMM-score: 17.2)
  Plasmid_toxin (CL0136) ParE-like_toxin; ParE-like toxin of type II bacterial toxin-antitoxin system (PF15781; HMM-score: 14.9)
  HAD (CL0137) HAD_PNKP; Polynucleotide kinase PNKP phosphatase domain (PF25109; HMM-score: 12.7)

⊟Structure, modifications & cofactors

• domains:
• modifications:
• cofactors:
• effectors:

⊟Localization

• PSORTb: unknown (no significant prediction)
  • Cytoplasmic Score: 2.5
  • Cytoplasmic Membrane Score: 2.5
  • Cellwall Score: 2.5
  • Extracellular Score: 2.5
  • Internal Helices: 0
• DeepLocPro: Cytoplasmic
  • Cytoplasmic Score: 0.9833
  • Cytoplasmic Membrane Score: 0.0009
  • Cell wall & surface Score: 0.0005
  • Extracellular Score: 0.0152
• LocateP:
• SignalP: no predicted signal peptide
  • SP(Sec/SPI): 0.004067
  • TAT(Tat/SPI): 0.000204
  • LIPO(Sec/SPII): 0.000498
• predicted transmembrane helices (TMHMM): 0

⊟Accession numbers

• GI: 445996193 NCBI
• RefSeq: WP_000074048 NCBI
• UniProt:

⊟Protein sequence

• MSNYTVKIKNSAKSDLKKIKHSYLKKSFLEIVETLKNDPYKITQSFEKLEPKYLERYSRRINHQHRVVYTVDDRNKEVLILSAWSHYD

⊟Experimental data

• experimentally validated:
• protein localization:
• quantitative data / protein copy number per cell:
• interaction partners:

⊟Expression & Regulation

⊟Operon

⊟Regulation

• regulator:

⊟Transcription pattern

• S.aureus Expression Data Browser: no data available

⊟Protein synthesis (provided by Aureolib)

• Aureolib: no data available

⊟Protein stability

• half-life: no data available

⊟Biological Material

⊟Mutants

⊟Expression vector

⊟lacZ fusion

⊟GFP fusion

⊟two-hybrid system

⊟FLAG-tag construct

⊟Antibody

⊟Other Information

You are kindly invited to share additional interesting facts.

⊟Literature

⊟References

⊟Relevant publications