Jump to navigation
Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS13570
- pan locus tag?:
- symbol: NWMN_RS13570
- pan gene symbol?: —
- synonym:
- product: Txe/YoeB family addiction module toxin
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS13570
- symbol: NWMN_RS13570
- product: Txe/YoeB family addiction module toxin
- replicon: chromosome
- strand: -
- coordinates: 2591865..2592131
- length: 267
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_009641 (2591865..2592131) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAGCAATTACACGGTTAAGATTAAAAATTCAGCGAAATCAGATTTAAAGAAAATAAAA
CATTCTTATTTAAAGAAGTCATTTTTAGAAATTGTTGAGACTTTAAAAAATGATCCGTAT
AAAATAACACAATCTTTTGAAAAATTAGAGCCTAAATATTTAGAGCGATATTCAAGAAGA
ATTAACCATCAGCACAGGGTCGTCTATACCGTAGATGATCGAAATAAAGAAGTATTAATA
CTATCGGCATGGTCACATTATGATTAA60
120
180
240
267
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS13570
- symbol: NWMN_RS13570
- description: Txe/YoeB family addiction module toxin
- length: 88
- theoretical pI: 10.1415
- theoretical MW: 10648.1
- GRAVY: -0.892045
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Toxin production and resistance addiction module toxin, Txe/YoeB family (TIGR02116; HMM-score: 99.4)Mobile and extrachromosomal element functions Other addiction module toxin, Txe/YoeB family (TIGR02116; HMM-score: 99.4)and 2 moreCellular processes Toxin production and resistance addiction module toxin, RelE/StbE family (TIGR02385; HMM-score: 21.2)Mobile and extrachromosomal element functions Other addiction module toxin, RelE/StbE family (TIGR02385; HMM-score: 21.2)
- TheSEED:
- PFAM: Plasmid-antitox (CL0136) YoeB_toxin; YoeB-like toxin of bacterial type II toxin-antitoxin system (PF06769; HMM-score: 38.1)and 6 moreParE_toxin; ParE toxin of type II toxin-antitoxin system, parDE (PF05016; HMM-score: 28.7)HigB-like_toxin; RelE-like toxin of type II toxin-antitoxin system HigB (PF05015; HMM-score: 19.7)ParE-like_toxin; ParE-like toxin of type II bacterial toxin-antitoxin system (PF15781; HMM-score: 18.4)no clan defined TINF2_N; TERF1-interacting nuclear factor 2 N-terminus (PF14973; HMM-score: 16.7)Met_repress (CL0057) VAPB_antitox; Putative antitoxin (PF02697; HMM-score: 16.3)HHH (CL0198) HHH_4; Helix-hairpin-helix containing domain (PF14490; HMM-score: 13.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004067
- TAT(Tat/SPI): 0.000204
- LIPO(Sec/SPII): 0.000498
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSNYTVKIKNSAKSDLKKIKHSYLKKSFLEIVETLKNDPYKITQSFEKLEPKYLERYSRRINHQHRVVYTVDDRNKEVLILSAWSHYD
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]