From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS14050 [old locus tag: NWMN_2444 ]
  • pan locus tag?: SAUPAN006205000
  • symbol: NWMN_RS14050
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS14050 [old locus tag: NWMN_2444 ]
  • symbol: NWMN_RS14050
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2686604..2686861
  • length: 258
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_009641 (2686604..2686861) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_2444

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGGAGATTATAATAGAGATTTATATGTATTTAAGAGATGGAATTAAAGAGCATTTTATT
    TTGAAAAAGGTTAGAAAAAAATTTAAAAAATTAAATGAGATTAACAGCGATATACAAAAT
    ATGTATGCAGAAAATCAGGGGCTCTTAGAAACAGATAAAACAATAATTGACAAGGTCTTA
    AGCACTGACGTTACAAATAGCCATGATATTAATGAATTATATTTATTTCTTAAAAACTAT
    TTGGATAAGACGCAATGA
    60
    120
    180
    240
    258


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS14050 [old locus tag: NWMN_2444 ]
  • symbol: NWMN_RS14050
  • description: hypothetical protein
  • length: 85
  • theoretical pI: 6.52886
  • theoretical MW: 10183.7
  • GRAVY: -0.464706

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see NWMN_2444
  • PFAM:
    CorA-like (CL0788) MRS2-like; Magnesium transporter MRS2-like (PF22099; HMM-score: 13.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.1808
    • Cytoplasmic Membrane Score: 0.1189
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.7003
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.001896
    • TAT(Tat/SPI): 0.000068
    • LIPO(Sec/SPII): 0.00044
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MEIIIEIYMYLRDGIKEHFILKKVRKKFKKLNEINSDIQNMYAENQGLLETDKTIIDKVLSTDVTNSHDINELYLFLKNYLDKTQ

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]