From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS14100 [old locus tag: NWMN_2453 ]
  • pan locus tag?: SAUPAN006216000
  • symbol: NWMN_RS14100
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS14100 [old locus tag: NWMN_2453 ]
  • symbol: NWMN_RS14100
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2699302..2699469
  • length: 168
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_009641 (2699302..2699469) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_2453

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    GTGAGATACGTTATTTCAATAATAATGGGAATTGTATTAGCAATTTGGTCATTTAAACAA
    CTGAGTCAAAGTCATTTAGATAGCGGATTTATTTTTTTCTTCATAGTTTATGTGTTGTGT
    ATCAGTTGTTTTAATAGCGATAAGCACGATAAAAATAAAAAACGATAG
    60
    120
    168

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: NWMN_RS14100 [old locus tag: NWMN_2453 ]
  • symbol: NWMN_RS14100
  • description: hypothetical protein
  • length: 55
  • theoretical pI: 9.81263
  • theoretical MW: 6488.7
  • GRAVY: 0.474545

⊟Function[edit | edit source]

  • TIGRFAM:
    exosortase F-associated protein (TIGR04127; HMM-score: 15.6)
  • TheSEED: data available for NCTC8325
  • PFAM:
    no clan defined DUF3792; Protein of unknown function (DUF3792) (PF12670; HMM-score: 17.1)
    DUF2304; Uncharacterized conserved protein (DUF2304) (PF10066; HMM-score: 15.1)
    PqiA; Paraquat-inducible protein A (PF04403; HMM-score: 14)
    and 2 more
    Rab5ip; Rab5-interacting protein (Rab5ip) (PF07019; HMM-score: 13.5)
    LysE (CL0292) TauE; Sulfite exporter TauE/SafE (PF01925; HMM-score: 13.3)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.19773
    • TAT(Tat/SPI): 0.001333
    • LIPO(Sec/SPII): 0.077303
  • predicted transmembrane helices (TMHMM): 2

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MRYVISIIMGIVLAIWSFKQLSQSHLDSGFIFFFIVYVLCISCFNSDKHDKNKKR

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=NWMN_RS14100&oldid=88226"