From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS14125 [old locus tag: NWMN_2458 ]
  • pan locus tag?: SAUPAN006222000
  • symbol: NWMN_RS14125
  • pan gene symbol?: copZ
  • synonym:
  • product: copper chaperone CopZ

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS14125 [old locus tag: NWMN_2458 ]
  • symbol: NWMN_RS14125
  • product: copper chaperone CopZ
  • replicon: chromosome
  • strand: +
  • coordinates: 2705352..2705558
  • length: 207
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_009641 (2705352..2705558) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_2458

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGTCACAAGAAATTTTAAATGTTGAAGGTATGAGCTGTGGTCACTGCAAAAGTGCTGTT
    GAATCTGCATTAAATAATATTGACGGTGTCACTTCAGCTGACGTTAACCTTGAAAATGGT
    CAAGTAAGTGTTCAATATGATGACAGTAAAGTTGCTGTATCTCAAATGAAAGACGCAATT
    GAAGATCAAGGTTACGATGTCGTTTAA
    60
    120
    180
    207

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS14125 [old locus tag: NWMN_2458 ]
  • symbol: NWMN_RS14125
  • description: copper chaperone CopZ
  • length: 68
  • theoretical pI: 3.74526
  • theoretical MW: 7236.9
  • GRAVY: -0.25

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Cations and iron carrying compounds copper ion binding protein (TIGR00003; HMM-score: 72.3)
    and 1 more
    Cellular processes Cellular processes Detoxification mercuric transport protein periplasmic component (TIGR02052; HMM-score: 54)
  • TheSEED: see NWMN_2458
  • PFAM:
    HMA (CL0704) HMA; Heavy-metal-associated domain (PF00403; HMM-score: 68.2)
    and 5 more
    no clan defined DUF6286; Family of unknown function (DUF6286) (PF19803; HMM-score: 20.2)
    HMA (CL0704) HMA_2; Heavy metal associated domain 2 (PF19991; HMM-score: 17.5)
    no clan defined Vta1_C; Vta1 C-terminal domain (PF18097; HMM-score: 13.9)
    Zn_Beta_Ribbon (CL0167) DUF7479; Domain of unknown function (DUF7479) (PF24292; HMM-score: 12.7)
    Zn_ribbon_DUF2089; DUF2089 zinc ribbon (PF22747; HMM-score: 12.5)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9785
    • Cytoplasmic Membrane Score: 0.0028
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0186
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.016738
    • TAT(Tat/SPI): 0.001113
    • LIPO(Sec/SPII): 0.004887
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MSQEILNVEGMSCGHCKSAVESALNNIDGVTSADVNLENGQVSVQYDDSKVAVSQMKDAIEDQGYDVV

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]