Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA0075 [new locus tag: SA_RS00515 ]
- pan locus tag?: SAUPAN000740000
- symbol: SA0075
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA0075 [new locus tag: SA_RS00515 ]
- symbol: SA0075
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 84467..84799
- length: 333
- essential: no DEG
⊟Accession numbers[edit | edit source]
- Gene ID: 1122849 NCBI
- RefSeq: NP_373316 NCBI
- BioCyc:
- MicrobesOnline: 102342 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATTTTCAATAAATATTATACAAAAGAAGAAGTTGTAATTTCTACTTTGCAAACCCTTGCT
AGTAAATTTGAAGATTTAGATATAGACAGTCACGACAATTTGAATAGTTTCAAAGCACGC
ATCGGCAGTACTATCGATAAGTTAGCTAAAGCTCCACCCCTTAATAAGTATACATTTACT
GAATTAATGATTATCATATCTATAATTTACTTCAAAAACCTGTATATTGGAAGATTAGAT
AAACCTTCATCGAGGAAGAAAAAAGGAGGTAATTTAATTTTTGAGATAGTTTATAATAAT
CAAATGCTTAATTCCTCAACCGCCAAACTATAA60
120
180
240
300
333
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA0075 [new locus tag: SA_RS00515 ]
- symbol: SA0075
- description: hypothetical protein
- length: 110
- theoretical pI: 9.94077
- theoretical MW: 12631.6
- GRAVY: -0.252727
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 0.24
- Cytoplasmic Membrane Score: 0.05
- Cellwall Score: 0.8
- Extracellular Score: 8.91
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.2662
- Cytoplasmic Membrane Score: 0.0349
- Cell wall & surface Score: 0
- Extracellular Score: 0.6989
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 2
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.008012
- TAT(Tat/SPI): 0.000283
- LIPO(Sec/SPII): 0.002534
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MFNKYYTKEEVVISTLQTLASKFEDLDIDSHDNLNSFKARIGSTIDKLAKAPPLNKYTFTELMIIISIIYFKNLYIGRLDKPSSRKKKGGNLIFEIVYNNQMLNSSTAKL
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SA0074 < SA0075 < SA0076
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]