From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0241 [new locus tag: SA_RS01425 ]
  • pan locus tag?: SAUPAN001123000
  • symbol: ispD
  • pan gene symbol?: tarI'
  • synonym:
  • product: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA0241 [new locus tag: SA_RS01425 ]
  • symbol: ispD
  • product: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
  • replicon: chromosome
  • strand: +
  • coordinates: 292918..293634
  • length: 717
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGATTTATGCAGGTATTTTAGCAGGAGGTATTGGTTCGAGAATGGGGAACGTGCCATTA
    CCAAAACAATTTTTAGATATTGATAATAAACCGATTTTAATCCATACAATTGAGAAGTTC
    ATTTTAGTGAGTGAATTTAATGAGATTATTATCGCAACGCCAGCACAGTGGATTTCCCAT
    ACACAGGATATTTTAAAAAAATATAACATTACAGATCAACGTGTCAAAGTAGTTGCAGGT
    GGTACGGATCGAAACGAAACAATTATGAACATTATCGACCATATTCGCAATGTAAATGGA
    ATTAATAATGATGATGTGATTGTAACTCATGATGCCGTAAGACCATTTTTAACTCAACGT
    ATTATTAAAGAGAACATTGAAGTAGCAGCAAAATATGGTGCAGTAGATACAGTCATTGAA
    GCAATTGATACGATTGTAATGTCTAAAGATAAACAGAACATACACAGTATCCCTGTAAGG
    AATGAAATGTATCAAGGCCAAACACCACAATCATTTAATATTAAATTATTACAAGATAGT
    TATCGCGCCTTAAGTAGTGAACAAAAAGAAATCTTATCAGATGCATGTAAAATAATTGTC
    GAATCTGGACATGCAGTTAAATTGGTACGTGGAGAACTATACAACATTAAAGTGACAACA
    CCGTATGATTTAAAAGTAGCAAATGCCATTATTCAAGGTGATATTGCCGATGATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    717

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA0241 [new locus tag: SA_RS01425 ]
  • symbol: IspD
  • description: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
  • length: 238
  • theoretical pI: 5.95177
  • theoretical MW: 26574.4
  • GRAVY: -0.0890756

Function[edit | edit source]

  • reaction:
    EC 2.7.7.40?  ExPASy
    D-ribitol-5-phosphate cytidylyltransferase CTP + D-ribitol 5-phosphate = diphosphate + CDP-ribitol
    EC 2.7.7.60?  ExPASy
    2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase CTP + 2-C-methyl-D-erythritol 4-phosphate = diphosphate + 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol
  • TIGRFAM:
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (TIGR00453; EC 2.7.7.60; HMM-score: 159.1)
    and 7 more
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides 3-deoxy-D-manno-octulosonate cytidylyltransferase (TIGR00466; EC 2.7.7.38; HMM-score: 21.1)
    molybdenum cofactor cytidylyltransferase (TIGR03310; EC 2.7.7.76; HMM-score: 21.1)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin molybdenum cofactor guanylyltransferase (TIGR02665; EC 2.7.7.77; HMM-score: 19.1)
    glucose-1-phosphate thymidylyltransferase (TIGR01208; EC 2.7.7.24; HMM-score: 17)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides glucose-1-phosphate cytidylyltransferase (TIGR02623; EC 2.7.7.33; HMM-score: 16.6)
    pseudaminic acid cytidylyltransferase (TIGR03584; EC 2.7.7.81; HMM-score: 13.8)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides glucose-1-phosphate thymidylyltransferase (TIGR01207; EC 2.7.7.24; HMM-score: 12.6)
  • TheSEED:  
    Cell Wall and Capsule Gram-Positive cell wall components Teichoic and lipoteichoic acids biosynthesis  2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60)
    and 3 more
    ribitol-5-phosphate cytidylyltransferase (EC 2.7.7.40)
    Fatty Acids, Lipids, and Isoprenoids Isoprenoids Isoprenoid Biosynthesis  2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60)
    Miscellaneous Plant-Prokaryote comparative genomics Competence or DNA damage-inducible protein CinA and related protein families  2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60)
  • PFAM:
    GT-A (CL0110) IspD; 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (PF01128; HMM-score: 148)
    and 3 more
    NTP_transf_3; MobA-like NTP transferase domain (PF12804; HMM-score: 36.1)
    CTP_transf_3; Cytidylyltransferase (PF02348; HMM-score: 20.3)
    NTP_transferase; Nucleotidyl transferase (PF00483; HMM-score: 17.9)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003261
    • TAT(Tat/SPI): 0.000131
    • LIPO(Sec/SPII): 0.000908
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MIYAGILAGGIGSRMGNVPLPKQFLDIDNKPILIHTIEKFILVSEFNEIIIATPAQWISHTQDILKKYNITDQRVKVVAGGTDRNETIMNIIDHIRNVNGINNDDVIVTHDAVRPFLTQRIIKENIEVAAKYGAVDTVIEAIDTIVMSKDKQNIHSIPVRNEMYQGQTPQSFNIKLLQDSYRALSSEQKEILSDACKIIVESGHAVKLVRGELYNIKVTTPYDLKVANAIIQGDIADD

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]