NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA0456 [new locus tag: SA_RS02625 ]
- pan locus tag?: SAUPAN002236000
- symbol: spoVG
- pan gene symbol?: spoVG
- synonym:
- product: regulatory protein SpoVG
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA0456 [new locus tag: SA_RS02625 ]
- symbol: spoVG
- product: regulatory protein SpoVG
- replicon: chromosome
- strand: +
- coordinates: 526400..526702
- length: 303
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1123247 NCBI
- RefSeq: NP_373708 NCBI
- BioCyc:
- MicrobesOnline: 102734 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAAAGTGACAGATGTAAGACTTAGAAAAATACAAACAGATGGACGAATGAAAGCACTC
GTTTCCATTACATTAGATGAAGCTTTCGTAATTCATGATTTACGTGTAATTGAAGGAAAC
TCTGGCTTGTTCGTTGCAATGCCAAGTAAACGTACACCAGATGGTGAATTCCGCGACATC
GCGCATCCTATTAATTCAGATATGAGACAAGAAATTCAAGATGCAGTGATGAAAGTATAT
GATGAAACAGATGAAGTAGTACCAGATAAAAACGCTACATCAGAAGATTCAGAAGAAGCT
TAA60
120
180
240
300
303
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA0456 [new locus tag: SA_RS02625 ]
- symbol: SpoVG
- description: regulatory protein SpoVG
- length: 100
- theoretical pI: 4.40086
- theoretical MW: 11277.6
- GRAVY: -0.511
⊟Function[edit | edit source]
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004666
- TAT(Tat/SPI): 0.000312
- LIPO(Sec/SPII): 0.000451
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKVTDVRLRKIQTDGRMKALVSITLDEAFVIHDLRVIEGNSGLFVAMPSKRTPDGEFRDIAHPINSDMRQEIQDAVMKVYDETDEVVPDKNATSEDSEEA
⊟Experimental data[edit | edit source]
- experimentally validated: no data available
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: ipk > purR > SA0455 > spoVG
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
Alexander Scherl, Patrice François, Manuela Bento, Jacques M Deshusses, Yvan Charbonnier, Véronique Converset, Antoine Huyghe, Nadia Walter, Christine Hoogland, Ron D Appel, Jean-Charles Sanchez, Catherine G Zimmermann-Ivol, Garry L Corthals, Denis F Hochstrasser, Jacques Schrenzel
Correlation of proteomic and transcriptomic profiles of Staphylococcus aureus during the post-exponential phase of growth.
J Microbiol Methods: 2005, 60(2);247-57
[PubMed:15590099] [WorldCat.org] [DOI] (P p)Alexandra Resch, Ralf Rosenstein, Christiane Nerz, Friedrich Götz
Differential gene expression profiling of Staphylococcus aureus cultivated under biofilm and planktonic conditions.
Appl Environ Microbiol: 2005, 71(5);2663-76
[PubMed:15870358] [WorldCat.org] [DOI] (P p)