Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA0580 [new locus tag: SA_RS03345 ]
- pan locus tag?: SAUPAN002496000
- symbol: SA0580
- pan gene symbol?: mnhC2
- synonym:
- product: monovalent cation/H+ antiporter subunit C
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA0580 [new locus tag: SA_RS03345 ]
- symbol: SA0580
- product: monovalent cation/H+ antiporter subunit C
- replicon: chromosome
- strand: +
- coordinates: 672786..673130
- length: 345
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1123386 NCBI
- RefSeq: NP_373834 NCBI
- BioCyc: see SA_RS03345
- MicrobesOnline: 102860 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAATTTAATATTATTACTAGTTATAGGATTTTTAGTGTTTATAGGAACATATATGATT
TTATCAATCAATTTAATTCGTATTGTAATCGGAATTTCAATATATACTCATGCTGGTAAT
CTCATTATTATGAGTATGGGAACGTATGGTTCTAGTAGATCAGAACCATTAATAACTGGT
GGAAACCAATTGTTTGTTGATCCCTTGTTACAAGCTATTGTACTAACTGCAATAGTTATA
GGGTTTGGGATGACTGCGTTTTTACTTGTACTTGTTTATAGAACTTATAAAGTAACAAAA
GAAGATGAAATTGAAGGCCTAAGGGGGGAAGATGATGCTAAGTAA60
120
180
240
300
345
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA0580 [new locus tag: SA_RS03345 ]
- symbol: SA0580
- description: monovalent cation/H+ antiporter subunit C
- length: 114
- theoretical pI: 4.93178
- theoretical MW: 12495.9
- GRAVY: 0.886842
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds multicomponent Na+:H+ antiporter, MnhC subunit (TIGR00941; HMM-score: 99.1)
- TheSEED :
- Na(+) H(+) antiporter subunit C (TC 2.A.63.1.3)
- PFAM: no clan defined Oxidored_q2; NADH-ubiquinone/plastoquinone oxidoreductase chain 4L (PF00420; HMM-score: 82.6)and 2 moreOst4; Oligosaccaryltransferase (PF10215; HMM-score: 16)DUF2070; Predicted membrane protein (DUF2070) (PF09843; HMM-score: 8.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9994
- Cell wall & surface Score: 0
- Extracellular Score: 0.0006
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.040897
- TAT(Tat/SPI): 0.000516
- LIPO(Sec/SPII): 0.004452
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMSMGTYGSSRSEPLITGGNQLFVDPLLQAIVLTAIVIGFGMTAFLLVLVYRTYKVTKEDEIEGLRGEDDAK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]