From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0644 [new locus tag: SA_RS03680 ]
  • pan locus tag?: SAUPAN002573000
  • symbol: SA0644
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA0644 [new locus tag: SA_RS03680 ]
  • symbol: SA0644
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 738059..738346
  • length: 288
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGACAAACGAAGATAAACGTTTCGAACAATTAAGATTTGAACGCAAATTTATAGTTATT
    CCGTATTTAATTTATGCAGTCATTGTATTACTATTAAATATTTTCTATTCTGATTTGAAA
    ATAACAATGACATTATTCGGACTTTTCTTTGCGTATAATGTAGTCATTTTGTTCATAGCA
    TTTATTAAACATTATAAACGCACATTGTTACTAAGTCTTATATTAACAGTGCTTAGTGGC
    GCGGCATTCTTTGGAATTATTTATGTTTATGGCATTAATCATTTTTAA
    60
    120
    180
    240
    288

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA0644 [new locus tag: SA_RS03680 ]
  • symbol: SA0644
  • description: hypothetical protein
  • length: 95
  • theoretical pI: 9.85429
  • theoretical MW: 11240.5
  • GRAVY: 0.991579

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • FIG01107862: hypothetical protein
  • PFAM:
    no clan defined DUF6442; Family of unknown function (DUF6442) (PF20040; HMM-score: 12.1)
    PIG-F; GPI biosynthesis protein family Pig-F (PF06699; HMM-score: 10.3)
    and 3 more
    DUF6404; Family of unknown function (DUF6404) (PF19942; HMM-score: 9.1)
    DUF2070; Predicted membrane protein (DUF2070) (PF09843; HMM-score: 8.5)
    Hybrid (CL0105) DUF2254; Predicted membrane protein (DUF2254) (PF10011; HMM-score: 6.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0001
    • Cytoplasmic Membrane Score: 0.997
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0029
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.000787
    • TAT(Tat/SPI): 0.000173
    • LIPO(Sec/SPII): 0.013848
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTNEDKRFEQLRFERKFIVIPYLIYAVIVLLLNIFYSDLKITMTLFGLFFAYNVVILFIAFIKHYKRTLLLSLILTVLSGAAFFGIIYVYGINHF

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]