Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA0712 [new locus tag: SA_RS04055 ]
- pan locus tag?: SAUPAN002671000
- symbol: SA0712
- pan gene symbol?: csbA
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA0712 [new locus tag: SA_RS04055 ]
- symbol: SA0712
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 812436..812672
- length: 237
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1123519 NCBI
- RefSeq: NP_373967 NCBI
- BioCyc: see SA_RS04055
- MicrobesOnline: 102993 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGATATGGTATTTTAGCGCAGCATTCTTTCCATGTGTCTTGGTAGTATTATTTAGTGTA
ATAACAAGAAGTAAATGGGTCGGTACTATTCTGACATTAATTTTAATTGGTGCCTCAATC
TATAAAGAGTATTTCCATAACGAGTGGATTATTTTTATTGATGTAGTGTCATTATTAGCT
GGTTATTTAATTATAGATCAACTCGAATTTCATAAACATCAAGATGAAGATCGCTAA60
120
180
237
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA0712 [new locus tag: SA_RS04055 ]
- symbol: SA0712
- description: hypothetical protein
- length: 78
- theoretical pI: 5.49047
- theoretical MW: 9197.76
- GRAVY: 0.752564
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- FIG01108261: hypothetical protein
- PFAM: no clan defined DUF2198; Uncharacterized protein conserved in bacteria (DUF2198) (PF09964; HMM-score: 112.8)and 5 moreTgpA_N; TgpA N-terminal domain (PF11992; HMM-score: 17)Peptidase_MA (CL0126) Peptidase_M50B; Peptidase M50B-like (PF13398; HMM-score: 14.9)no clan defined DUF7670; Domain of unknown function (DUF7670) (PF24709; HMM-score: 13.9)LiaI-LiaF-TM (CL0800) LiaF-TM; LiaF transmembrane domain (PF22570; HMM-score: 11.6)no clan defined Spore_YhaL; Sporulation protein YhaL (PF14147; HMM-score: 8.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0001
- Cytoplasmic Membrane Score: 0.9974
- Cell wall & surface Score: 0
- Extracellular Score: 0.0025
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003292
- TAT(Tat/SPI): 0.000759
- LIPO(Sec/SPII): 0.012477
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIWYFSAAFFPCVLVVLFSVITRSKWVGTILTLILIGASIYKEYFHNEWIIFIDVVSLLAGYLIIDQLEFHKHQDEDR
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]