From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0712 [new locus tag: SA_RS04055 ]
  • pan locus tag?: SAUPAN002671000
  • symbol: SA0712
  • pan gene symbol?: csbA
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA0712 [new locus tag: SA_RS04055 ]
  • symbol: SA0712
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 812436..812672
  • length: 237
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGATATGGTATTTTAGCGCAGCATTCTTTCCATGTGTCTTGGTAGTATTATTTAGTGTA
    ATAACAAGAAGTAAATGGGTCGGTACTATTCTGACATTAATTTTAATTGGTGCCTCAATC
    TATAAAGAGTATTTCCATAACGAGTGGATTATTTTTATTGATGTAGTGTCATTATTAGCT
    GGTTATTTAATTATAGATCAACTCGAATTTCATAAACATCAAGATGAAGATCGCTAA
    60
    120
    180
    237

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SA0712 [new locus tag: SA_RS04055 ]
  • symbol: SA0712
  • description: hypothetical protein
  • length: 78
  • theoretical pI: 5.49047
  • theoretical MW: 9197.76
  • GRAVY: 0.752564

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • FIG01108261: hypothetical protein
  • PFAM:
    no clan defined DUF2198; Uncharacterized protein conserved in bacteria (DUF2198) (PF09964; HMM-score: 113.3)
    and 2 more
    Peptidase_MA (CL0126) Peptidase_M50B; Peptidase M50B-like (PF13398; HMM-score: 14.8)
    no clan defined Spore_YhaL; Sporulation protein YhaL (PF14147; HMM-score: 8.2)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003292
    • TAT(Tat/SPI): 0.000759
    • LIPO(Sec/SPII): 0.012477
  • predicted transmembrane helices (TMHMM): 3

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MIWYFSAAFFPCVLVVLFSVITRSKWVGTILTLILIGASIYKEYFHNEWIIFIDVVSLLAGYLIIDQLEFHKHQDEDR

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SA0712&oldid=92844"