From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0983 [new locus tag: SA_RS05570 ]
  • pan locus tag?: SAUPAN003368000
  • symbol: isdG
  • pan gene symbol?: isdG
  • synonym:
  • product: heme-degrading monooxygenase IsdG

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA0983 [new locus tag: SA_RS05570 ]
  • symbol: isdG
  • product: heme-degrading monooxygenase IsdG
  • replicon: chromosome
  • strand: +
  • coordinates: 1112486..1112809
  • length: 324
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAAATTTATGGCAGAAAATAGGCTGACGTTAACAAAAGGAACAGCAAAAGATATTATA
    GAACGATTTTACACGAGACATGGGATTGAAACATTAGAAGGCTTTGATGGCATGTTTGTT
    ACACAAACTTTAGAACAAGAAGATTTTGATGAAGTGAAAATTTTAACAGTTTGGAAATCA
    AAGCAAGCTTTTACGGATTGGTTAAAATCTGATGTCTTTAAAGCAGCGCATAAACATGTT
    AGAAGTAAAAATGAAGATGAAAGTAGCCCGATTATCAATAACAAAGTAATTACATATGAT
    ATAGGCTATAGTTACATGAAATAA
    60
    120
    180
    240
    300
    324


Protein[edit | edit source]

Protein Data Bank: 2ZDO

General[edit | edit source]

  • locus tag: SA0983 [new locus tag: SA_RS05570 ]
  • symbol: IsdG
  • description: heme-degrading monooxygenase IsdG
  • length: 107
  • theoretical pI: 6.80692
  • theoretical MW: 12546.2
  • GRAVY: -0.566355

Function[edit | edit source]

  • reaction:
    EC 1.14.99.3?  ExPASy
    Transferred entry: 1.14.14.18
    EC 1.14.99.48?  ExPASy
    Heme oxygenase (staphylobilin-producing) Protoheme + 5 reduced acceptor + 4 O2 = 5-oxo-delta-bilirubin + Fe2+ + formaldehyde + 5 acceptor + 4 H2O Protoheme + 5 reduced acceptor + 4 O2 = 15-oxo-beta-bilirubin + Fe2+ + formaldehyde + 5 acceptor + 4 H2O
  • TIGRFAM:
    Metabolism Amino acid biosynthesis Aspartate family homoserine O-succinyltransferase (TIGR01001; EC 2.3.1.46; HMM-score: 15.8)
  • TheSEED  :
    • Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48)
    Iron acquisition and metabolism Iron acquisition and metabolism - no subcategory Heme, hemin uptake and utilization systems in GramPositives  Heme-degrading cytoplasmic oxygenase IsdG
  • PFAM:
    Dim_A_B_barrel (CL0032) ABM; Antibiotic biosynthesis monooxygenase (PF03992; HMM-score: 52.9)
    and 3 more
    Glutaminase_I (CL0014) HTS; Homoserine O-succinyltransferase (PF04204; HMM-score: 15.4)
    HTH (CL0123) KilA-N; KilA-N domain (PF04383; HMM-score: 13.5)
    Dim_A_B_barrel (CL0032) Dehydratase_hem; Haem-containing dehydratase (PF13816; HMM-score: 12.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9587
    • Cytoplasmic Membrane Score: 0.024
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0171
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002024
    • TAT(Tat/SPI): 0.000226
    • LIPO(Sec/SPII): 0.000347
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MKFMAENRLTLTKGTAKDIIERFYTRHGIETLEGFDGMFVTQTLEQEDFDEVKILTVWKSKQAFTDWLKSDVFKAAHKHVRSKNEDESSPIINNKVITYDIGYSYMK

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: Fur* (repression) regulon
    Fur*(TF)important in Iron homeostasis; RegPrecise 

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Michelle L Reniere, Eric P Skaar
    Staphylococcus aureus haem oxygenases are differentially regulated by iron and haem.
    Mol Microbiol: 2008, 69(5);1304-15
    [PubMed:18643935] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]

Woo Cheol Lee, Michelle L Reniere, Eric P Skaar, Michael E P Murphy
Ruffling of metalloporphyrins bound to IsdG and IsdI, two heme-degrading enzymes in Staphylococcus aureus.
J Biol Chem: 2008, 283(45);30957-63
[PubMed:18713745] [WorldCat.org] [DOI] (P p)
Michelle L Reniere, Georgia N Ukpabi, S Reese Harry, Donald F Stec, Robert Krull, David W Wright, Brian O Bachmann, Michael E Murphy, Eric P Skaar
The IsdG-family of haem oxygenases degrades haem to a novel chromophore.
Mol Microbiol: 2010, 75(6);1529-38
[PubMed:20180905] [WorldCat.org] [DOI] (I p)