From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1021 [new locus tag: SA_RS05820 ]
  • pan locus tag?: SAUPAN003448000
  • symbol: SA1021
  • pan gene symbol?: mraZ
  • synonym:
  • product: cell division protein MraZ

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA1021 [new locus tag: SA_RS05820 ]
  • symbol: SA1021
  • product: cell division protein MraZ
  • replicon: chromosome
  • strand: +
  • coordinates: 1156276..1156707
  • length: 432
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGTTCATGGGAGAATACGATCATCAATTAGATACAAAAGGACGTATGATTATACCGTCC
    AAGTTTCGTTATGACTTAAATGAGCGTTTTATTATCACAAGAGGCCTTGATAAATGTTTA
    TTCGGTTACACTCTAGACGAATGGCAACAGATTGAAGAGAAAATGAAAACCTTACCTATG
    ACAAAAAAAGACGCACGTAAGTTTATGCGTATGTTCTTCTCTGGTGCTGTTGAAGTAGAA
    CTTGATAAGCAAGGGCGTATTAACATCCCTCAAAACTTGAGGAAATACGCTAATTTAACT
    AAAGAATGTACAGTAATCGGTGTTTCAAATCGTATTGAGATTTGGGATAGAGAAACTTGG
    AATGATTTCTATGAAGAATCTGAAGAAAGTTTCGAAGATATTGCTGAAGATTTAATAGAT
    TTTGATTTTTAA
    60
    120
    180
    240
    300
    360
    420
    432

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA1021 [new locus tag: SA_RS05820 ]
  • symbol: SA1021
  • description: cell division protein MraZ
  • length: 143
  • theoretical pI: 4.52156
  • theoretical MW: 17237.5
  • GRAVY: -0.646154

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Cell division division/cell wall cluster transcriptional repressor MraZ (TIGR00242; HMM-score: 185.8)
    Signal transduction Regulatory functions DNA interactions division/cell wall cluster transcriptional repressor MraZ (TIGR00242; HMM-score: 185.8)
    and 2 more
    Signal transduction Regulatory functions DNA interactions transcriptional regulator, AbrB family (TIGR01439; HMM-score: 22.8)
    Hypothetical proteins Conserved TIGR02922 family protein (TIGR02922; HMM-score: 14.1)
  • TheSEED:  
    Cell Division and Cell Cycle Cell Division and Cell Cycle - no subcategory Bacterial Cytoskeleton  Cell division protein MraZ
    and 2 more
    Bacterial Cell Division  Cell division protein MraZ
    RP Bacterial Cell Division  Cell division protein MraZ
  • PFAM:
    AbrB (CL0132) MraZ; MraZ protein, putative antitoxin-like (PF02381; HMM-score: 175.3)
    and 1 more
    no clan defined DUF2375; Protein of unknown function (DUF2375) (PF09558; HMM-score: 14.9)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002774
    • TAT(Tat/SPI): 0.000201
    • LIPO(Sec/SPII): 0.000651
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MFMGEYDHQLDTKGRMIIPSKFRYDLNERFIITRGLDKCLFGYTLDEWQQIEEKMKTLPMTKKDARKFMRMFFSGAVEVELDKQGRINIPQNLRKYANLTKECTVIGVSNRIEIWDRETWNDFYEESEESFEDIAEDLIDFDF

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]