From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1039 [new locus tag: SA_RS05910 ]
  • pan locus tag?: SAUPAN003476000
  • symbol: lspA
  • pan gene symbol?: lspA
  • synonym:
  • product: lipoprotein signal peptidase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA1039 [new locus tag: SA_RS05910 ]
  • symbol: lspA
  • product: lipoprotein signal peptidase
  • replicon: chromosome
  • strand: +
  • coordinates: 1175975..1176466
  • length: 492
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGCACAAAAAATATTTTATTGGCACTTCCATTTTAATAGCAGTATTTGTCGTTATATTT
    GACCAAGTTACTAAATATATTATAGCTACTACAATGAAAATTGGAGATTCATTTGAAGTG
    ATACCGCACTTTTTAAACATAACATCACATCGAAATAATGGTGCTGCATGGGGAATATTG
    AGTGGAAAAATGACATTTTTCTTTATTATTACCATTATTATATTAATAGCCTTAGTATAT
    TTCTTTATTAAAGATGCTCAATATAATTTGTTTATGCAAGTTGCTATTAGTTTACTTTTT
    GCAGGTGCACTTGGAAACTTTATTGATAGAATTTTAACAGGAGAAGTTGTTGACTTTATT
    GATACAAATATTTTTGGTTATGATTTTCCAATATTTAATATAGCAGATTCAAGTTTAACA
    ATTGGTGTAATATTAATTATTATTGCCTTATTAAAGGATACTTCCAATAAAAAGGAGAAG
    GAGGTTAAGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    492

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA1039 [new locus tag: SA_RS05910 ]
  • symbol: LspA
  • description: lipoprotein signal peptidase
  • length: 163
  • theoretical pI: 7.75901
  • theoretical MW: 18341.6
  • GRAVY: 0.80184

Function[edit | edit source]

  • reaction:
    EC 3.4.23.36?  ExPASy
    Signal peptidase II Release of signal peptides from bacterial membrane prolipoproteins. Hydrolyzes -Xaa-Yaa-Zaa-|-(S,diacylglyceryl)Cys-, in which Xaa is hydrophobic (preferably Leu), and Yaa (Ala or Ser) and Zaa (Gly or Ala) have small, neutral side chains
  • TIGRFAM:
    Genetic information processing Protein fate Protein and peptide secretion and trafficking signal peptidase II (TIGR00077; EC 3.4.23.36; HMM-score: 135.8)
  • TheSEED:  
    Protein Metabolism Protein processing and modification Lipoprotein Biosynthesis  Lipoprotein signal peptidase (EC 3.4.23.36)
    and 2 more
    Signal peptidase  Lipoprotein signal peptidase (EC 3.4.23.36)
    Regulation and Cell signaling Regulation and Cell signaling - no subcategory Sex pheromones in Enterococcus faecalis and other Firmicutes  Lipoprotein signal peptidase (EC 3.4.23.36)
  • PFAM:
    no clan defined Peptidase_A8; Signal peptidase (SPase) II (PF01252; HMM-score: 123.9)
    and 3 more
    DUF2530; Protein of unknown function (DUF2530) (PF10745; HMM-score: 10.1)
    DUF4418; Domain of unknown function (DUF4418) (PF14387; HMM-score: 9.6)
    DUF3671; Protein of unknown function (PF12420; HMM-score: 7.6)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.236086
    • TAT(Tat/SPI): 0.000408
    • LIPO(Sec/SPII): 0.007547
  • predicted transmembrane helices (TMHMM): 4

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MHKKYFIGTSILIAVFVVIFDQVTKYIIATTMKIGDSFEVIPHFLNITSHRNNGAAWGILSGKMTFFFIITIIILIALVYFFIKDAQYNLFMQVAISLLFAGALGNFIDRILTGEVVDFIDTNIFGYDFPIFNIADSSLTIGVILIIIALLKDTSNKKEKEVK

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]