From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1176 [new locus tag: SA_RS06685 ]
  • pan locus tag?: SAUPAN003716000
  • symbol: SA1176
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA1176 [new locus tag: SA_RS06685 ]
  • symbol: SA1176
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1338267..1338506
  • length: 240
  • essential: yes DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    TTGAGTAATTCTGATTTGAATATCGAAAGAATTAACGAGTTAGCTAAAAAGAAAAAAGAA
    GTAGGATTAACTCAAGAAGAAGCAAAGGAGCAAACAGCCTTAAGAAAAGCTTATCTTGAG
    AGTTTTAGAAAAGGGTTTAAACAACAAATTGAAAATACTAAAGTAATTGATCCAGAAGGT
    AATGATGTAACACCTGAAAAAATTAAAGAGATACAACAAAAAAGAGATAATAAAAATTAA
    60
    120
    180
    240


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA1176 [new locus tag: SA_RS06685 ]
  • symbol: SA1176
  • description: hypothetical protein
  • length: 79
  • theoretical pI: 9.63152
  • theoretical MW: 9203.33
  • GRAVY: -1.32025

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing DNA metabolism DNA replication, recombination, and repair DNA (cytosine-5-)-methyltransferase (TIGR00675; EC 2.1.1.37; HMM-score: 14.4)
  • TheSEED  :
    • UPF0291 protein YnzC
  • PFAM:
    no clan defined DUF896; Bacterial protein of unknown function (DUF896) (PF05979; HMM-score: 108.8)
    and 1 more
    PH (CL0266) EbsA; EbsA-like protein (PF17255; HMM-score: 11.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9952
    • Cytoplasmic Membrane Score: 0.0006
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0042
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004735
    • TAT(Tat/SPI): 0.000565
    • LIPO(Sec/SPII): 0.000817
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MSNSDLNIERINELAKKKKEVGLTQEEAKEQTALRKAYLESFRKGFKQQIENTKVIDPEGNDVTPEKIKEIQQKRDNKN

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]