Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1264 [new locus tag: SA_RS07165 ]
- pan locus tag?: SAUPAN003863000
- symbol: SA1264
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1264 [new locus tag: SA_RS07165 ]
- symbol: SA1264
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1435843..1436028
- length: 186
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124102 NCBI
- RefSeq: NP_374545 NCBI
- BioCyc: see SA_RS07165
- MicrobesOnline: 103571 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATTTTAACTTTTTCAGAGCAAAATACACTCGCGAAAATAGATGATTTAATGAATACTTAT
TGCAATCAATGTCCAATCAAAACTCGTCTGCGTAAATTAGAGGGGAAAACGAAGGCGCAT
CATTTTTGTATCAATGAGTGTTCAATAGGGAAAGAAATAAAACAATTAGGAAATGAACTT
CAATAG60
120
180
186
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1264 [new locus tag: SA_RS07165 ]
- symbol: SA1264
- description: hypothetical protein
- length: 61
- theoretical pI: 8.33898
- theoretical MW: 7041.16
- GRAVY: -0.586885
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- FIG01108567: hypothetical protein
- PFAM: no clan defined zf-C2HCIx2C; Zinc-finger (PF10782; HMM-score: 91)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.089616
- TAT(Tat/SPI): 0.001498
- LIPO(Sec/SPII): 0.007679
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLTFSEQNTLAKIDDLMNTYCNQCPIKTRLRKLEGKTKAHHFCINECSIGKEIKQLGNELQ
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SA1261 < SA1262 < SA1263 < SA1264
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]