From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1421 [new locus tag: SA_RS08020 ]
  • pan locus tag?: SAUPAN004179000
  • symbol: SA1421
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA1421 [new locus tag: SA_RS08020 ]
  • symbol: SA1421
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1626895..1627479
  • length: 585
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGAACATTGAAAAAGCAAAACGGCTTGCAAAAGAGAAACTGCCAGAGAAACGTTATAAT
    CATTCTTTAAGAGTTGCAGAAACAGCGATTAAATTGGCAGAAATTTATGATGGAGACACT
    AGTAAAGTAGAATTAGCAGGTGTATTACATGATTTCTGTAAATATGATGATTTAGGTAAA
    ATGTATCAAATTGTTCGACAATACGAATTAGGTAATGATCTACTGAGTTATGGTAGTGAA
    ATATTGCATGGCCCTGTGTGTGCAGCAATCATGGAACATGAATATGGTATCAATGATGAG
    GAAGTATTAATGGCTATCAAATACCATACTACTGGACGTCAACAAATGACAAAAACTGAA
    AAACTGATTTTTATTGCTGATTACATCGAACCTGGAAGAACAATCCCAGGAGTTGATGAT
    ATTCGAGATATGGCATACAATCAAGGTAGTTTAGATAAGACAATTTATGAAATTTCTAAA
    CGCACAGTACTATTTTTAATACAGAAAGATATTACGGTATATAATAAGACGATTGACTGT
    TTAAATTATTATAACTATAGTGACGAAAGAATAAAGGATGATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    585

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA1421 [new locus tag: SA_RS08020 ]
  • symbol: SA1421
  • description: hypothetical protein
  • length: 194
  • theoretical pI: 5.15494
  • theoretical MW: 22463.5
  • GRAVY: -0.49433

Function[edit | edit source]

  • TIGRFAM:
    Unknown function Enzymes of unknown specificity putative HD superfamily hydrolase (TIGR00488; HMM-score: 140.2)
    and 4 more
    HDIG domain (TIGR00277; HMM-score: 24.5)
    Hypothetical proteins Conserved TIGR00295 family protein (TIGR00295; HMM-score: 18.9)
    HD domain protein, cyanamide hydratase family (TIGR03401; EC 4.2.1.-; HMM-score: 16.3)
    Genetic information processing Transcription Degradation of RNA ribonuclease Y (TIGR03319; EC 3.1.-.-; HMM-score: 11.2)
  • TheSEED:  
    Miscellaneous Plant-Prokaryote comparative genomics IojapClusters  Hydrolase (HAD superfamily), YqeK
    and 1 more
    Hydrolase (HD superfamily), YqeK
  • PFAM:
    HD_PDEase (CL0237) HD; HD domain (PF01966; HMM-score: 44)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005836
    • TAT(Tat/SPI): 0.000227
    • LIPO(Sec/SPII): 0.000722
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MNIEKAKRLAKEKLPEKRYNHSLRVAETAIKLAEIYDGDTSKVELAGVLHDFCKYDDLGKMYQIVRQYELGNDLLSYGSEILHGPVCAAIMEHEYGINDEEVLMAIKYHTTGRQQMTKTEKLIFIADYIEPGRTIPGVDDIRDMAYNQGSLDKTIYEISKRTVLFLIQKDITVYNKTIDCLNYYNYSDERIKDD

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]