Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1445 [new locus tag: SA_RS08145 ]
- pan locus tag?: SAUPAN004214000
- symbol: SA1445
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1445 [new locus tag: SA_RS08145 ]
- symbol: SA1445
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1646191..1646451
- length: 261
- essential: yes [1] DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124287 NCBI
- RefSeq: NP_374730 NCBI
- BioCyc:
- MicrobesOnline: 103756 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGGAAAACTTTGATAAAACAATGAAATTCGACTATGAAGAACTTCCAACGCAAGATGTA
AGAGATGTTTTAAATAATGTTTATCGAACATTAGATGAACGAGGATATAATGCCGTAAAC
CAAATTGTAGGTTATTTATTATCAGGTGACCCTGCGTATATTCCACGCCAGAATGAAGCA
AGAAATCAAATTCGTCATATTGATAGAGATGTTATTATGGAAGAACTTGTTTCTTACTAT
TTAAAAGAGCAAAATAAATAA60
120
180
240
261
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1445 [new locus tag: SA_RS08145 ]
- symbol: SA1445
- description: hypothetical protein
- length: 86
- theoretical pI: 4.49796
- theoretical MW: 10303.4
- GRAVY: -0.876744
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM: no clan defined DUF965; Bacterial protein of unknown function (DUF965) (PF06135; HMM-score: 114.1)and 1 more4HB_MCP (CL0457) CHASE3; CHASE3 domain (PF05227; HMM-score: 13.9)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005329
- TAT(Tat/SPI): 0.000569
- LIPO(Sec/SPII): 0.00066
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MENFDKTMKFDYEELPTQDVRDVLNNVYRTLDERGYNAVNQIVGYLLSGDPAYIPRQNEARNQIRHIDRDVIMEELVSYYLKEQNK
⊟Experimental data[edit | edit source]
- experimentally validated: no data available
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SA1443 < SA1444 < SA1445 < alaS
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑
R Allyn Forsyth, Robert J Haselbeck, Kari L Ohlsen, Robert T Yamamoto, Howard Xu, John D Trawick, Daniel Wall, Liangsu Wang, Vickie Brown-Driver, Jamie M Froelich, Kedar G C, Paula King, Melissa McCarthy, Cheryl Malone, Brian Misiner, David Robbins, Zehui Tan, Zhan-yang Zhu Zy, Grant Carr, Deborah A Mosca, Carlos Zamudio, J Gordon Foulkes, Judith W Zyskind
A genome-wide strategy for the identification of essential genes in Staphylococcus aureus.
Mol Microbiol: 2002, 43(6);1387-400
[PubMed:11952893] [WorldCat.org] [DOI] (P p)
⊟Relevant publications[edit | edit source]