From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1600 [new locus tag: SA_RS09010 ]
  • pan locus tag?: SAUPAN004480000
  • symbol: SA1600
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA1600 [new locus tag: SA_RS09010 ]
  • symbol: SA1600
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1837870..1838172
  • length: 303
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGTCTCGTTCAAAAAAATACTTTTACTTATCTAGCTTAATGATTATTTTAAGCTTTTTC
    TTTAATACAAATAACGTTTTCCTAAGTGGATTTTTTAATTCTTTTATTAAATTAATACTT
    TTCTGCAGTGTTATTAACTCAATTGTACTAATTTTGTCTATAATTTTTGCAGATCGTTCA
    ATTAAATCACTAAAGCCTGATGCAGATTGGATTAGAATTGCGAGTAAAAGTTTGCCTTGG
    ATTATTCTAATTGTTATTTTAGTACATATCTTTTCAATTGTTCGTACATTCGGTTTTATT
    TAA
    60
    120
    180
    240
    300
    303


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA1600 [new locus tag: SA_RS09010 ]
  • symbol: SA1600
  • description: hypothetical protein
  • length: 100
  • theoretical pI: 10.8622
  • theoretical MW: 11574.9
  • GRAVY: 1.1

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Adaptations to atypical conditions phage shock protein G (TIGR02975; HMM-score: 7.4)
  • TheSEED  :
    • Hypothetical protein SAV1782
  • PFAM:
    no clan defined Phageshock_PspG; Phage shock protein G (Phageshock_PspG) (PF09583; HMM-score: 10)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0001
    • Cytoplasmic Membrane Score: 0.9813
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0185
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.016174
    • TAT(Tat/SPI): 0.000286
    • LIPO(Sec/SPII): 0.009341
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MSRSKKYFYLSSLMIILSFFFNTNNVFLSGFFNSFIKLILFCSVINSIVLILSIIFADRSIKSLKPDADWIRIASKSLPWIILIVILVHIFSIVRTFGFI

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]