Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1600 [new locus tag: SA_RS09010 ]
- pan locus tag?: SAUPAN004480000
- symbol: SA1600
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1600 [new locus tag: SA_RS09010 ]
- symbol: SA1600
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1837870..1838172
- length: 303
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124446 NCBI
- RefSeq: NP_374889 NCBI
- BioCyc: see SA_RS09010
- MicrobesOnline: 103915 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGTCTCGTTCAAAAAAATACTTTTACTTATCTAGCTTAATGATTATTTTAAGCTTTTTC
TTTAATACAAATAACGTTTTCCTAAGTGGATTTTTTAATTCTTTTATTAAATTAATACTT
TTCTGCAGTGTTATTAACTCAATTGTACTAATTTTGTCTATAATTTTTGCAGATCGTTCA
ATTAAATCACTAAAGCCTGATGCAGATTGGATTAGAATTGCGAGTAAAAGTTTGCCTTGG
ATTATTCTAATTGTTATTTTAGTACATATCTTTTCAATTGTTCGTACATTCGGTTTTATT
TAA60
120
180
240
300
303
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1600 [new locus tag: SA_RS09010 ]
- symbol: SA1600
- description: hypothetical protein
- length: 100
- theoretical pI: 10.8622
- theoretical MW: 11574.9
- GRAVY: 1.1
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Adaptations to atypical conditions phage shock protein G (TIGR02975; HMM-score: 7.4)
- TheSEED :
- Hypothetical protein SAV1782
- PFAM: no clan defined Phageshock_PspG; Phage shock protein G (Phageshock_PspG) (PF09583; HMM-score: 10)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0001
- Cytoplasmic Membrane Score: 0.9813
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0185
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: 0.5
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.016174
- TAT(Tat/SPI): 0.000286
- LIPO(Sec/SPII): 0.009341
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSRSKKYFYLSSLMIILSFFFNTNNVFLSGFFNSFIKLILFCSVINSIVLILSIIFADRSIKSLKPDADWIRIASKSLPWIILIVILVHIFSIVRTFGFI
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]