From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1653 [new locus tag: SA_RS09345 ]
  • pan locus tag?: SAUPAN004760000
  • symbol: TRAP
  • pan gene symbol?: traP
  • synonym:
  • product: signal transduction protein TRAP

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA1653 [new locus tag: SA_RS09345 ]
  • symbol: TRAP
  • product: signal transduction protein TRAP
  • replicon: chromosome
  • strand: +
  • coordinates: 1887575..1888078
  • length: 504
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGAAGAAACTATATACATCTTATGGCACTTATGGATTTTTACATCAAATAAAAATCAAT
    AACCCGACCCATCAACTATTCCAATTTTCAGCATCAGATACTTCAGTTATTTTTGAAGAA
    ACTGATGGTGAGACTGTTTTAAAATCACCTTCAATATATGAAGTTATTAAAGAAATTGGT
    GAATTCAGTGAACATCATTTCTATTGTGCAATCTTCATTCCTTCAACAGAAGATCATGCA
    TATCAACTTGAAAAGAAACTGATTAGTGTAGACGATAATTTCAGAAACTTTGGTGGCTTT
    AAAAGCTATCGTTTGTTAAGACCTGCTAAAGGTACAACATATAAAATTTATTTCGGATTT
    GCTGATCGACATGCATACGAAGACTTTAAGCAATCTGATGCCTTTAATGACCATTTTTCA
    AAAGACGCATTAAGTCATTACTTTGGTTCAAGCGGACAACATTCAAGTTATTTTGAAAGA
    TATCTATACCCAATAAAAGAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    504

Protein[edit | edit source]

Protein Data Bank: 4AE5

General[edit | edit source]

  • locus tag: SA1653 [new locus tag: SA_RS09345 ]
  • symbol: TRAP
  • description: signal transduction protein TRAP
  • length: 167
  • theoretical pI: 6.60285
  • theoretical MW: 19547.6
  • GRAVY: -0.58024

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED:  
    Cofactors, Vitamins, Prosthetic Groups, Pigments Tetrapyrroles CPO analysis  Uncharacterized protein, homolog of B.subtilis yhgC
    and 1 more
    Experimental tye  Uncharacterized protein, homolog of B.subtilis yhgC
  • PFAM:
    Dim_A_B_barrel (CL0032) ABM; Antibiotic biosynthesis monooxygenase (PF03992; HMM-score: 18.6)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.016961
    • TAT(Tat/SPI): 0.000155
    • LIPO(Sec/SPII): 0.001289
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKKLYTSYGTYGFLHQIKINNPTHQLFQFSASDTSVIFEETDGETVLKSPSIYEVIKEIGEFSEHHFYCAIFIPSTEDHAYQLEKKLISVDDNFRNFGGFKSYRLLRPAKGTTYKIYFGFADRHAYEDFKQSDAFNDHFSKDALSHYFGSSGQHSSYFERYLYPIKE

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

  • TRAP no polycistronic organisation predicted

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]

Lindsey N Shaw, Ing-Marie Jonsson, Vineet K Singh, Andrej Tarkowski, George C Stewart
Inactivation of traP has no effect on the agr quorum-sensing system or virulence of Staphylococcus aureus.
Infect Immun: 2007, 75(9);4519-27
[PubMed:17548478] [WorldCat.org] [DOI] (P p)
Laura H Tsang, Sonja T Daily, Elizabeth C Weiss, Mark S Smeltzer
Mutation of traP in Staphylococcus aureus has no impact on expression of agr or biofilm formation.
Infect Immun: 2007, 75(9);4528-33
[PubMed:17548479] [WorldCat.org] [DOI] (P p)