From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1950 [new locus tag: SA_RS11195 ]
  • pan locus tag?: SAUPAN005449000
  • symbol: SA1950
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA1950 [new locus tag: SA_RS11195 ]
  • symbol: SA1950
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2198997..2199659
  • length: 663
  • essential: no DEG

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    TTGAATACAATAGAATCACAGTTTGATAAGGTTGCAGAAGATTACGATTTCGTGAATGAG
    CTTTTGAATGATTATTCATTCTTTGTGTCTAATATGTCTCCAAAGAAAGGCAGAGCATTA
    GATATCGGATGTGGCTCGGGTTTGTTAGTGGAGAAATTAGCAAGTTATTATGATGAAGTG
    GTAGGGATTGATATTTCTAATCAAATGCTCGATCTTGCCAAATCTAAACGTCAACTAACA
    AATACGGTCTATCTGAATATGAATGCAGAACAACTTAATTTTAATGAGAAGTTTGATTTT
    ATTGTAAGCCGAACAACCTTTCATCATTTGGATGATATAGCCAGCGTAATACAGCAAATG
    AAGGAACTGTTGAATGAGGAAGGAAGAATAGTTATTCTTGATAATGTATCTGAAGTCGAG
    ACACCGCCTACCTATGTTTATAAATTAGGGGCAATCCAAGAGTTTTTACCGCATTGTTTC
    AAATTTGGAATAAAAAATGCGATTAGAATTTATAATCACAACACATCTAAATCATGGCTT
    GAGCATTTAGCTTCAGATAAGTACCTATCTGAACAAAATTATTACGATTTATATGAAAAG
    TTGTTGCCTGGATGCCAATTCCATAAAATGGGTTGGGCAATGGGGGTTGTCTGGACAAAA
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    663


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA1950 [new locus tag: SA_RS11195 ]
  • symbol: SA1950
  • description: hypothetical protein
  • length: 220
  • theoretical pI: 4.95042
  • theoretical MW: 25439.8
  • GRAVY: -0.292273

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Biotin malonyl-acyl carrier protein O-methyltransferase BioC (TIGR02072; EC 2.1.1.-; HMM-score: 67.8)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone ubiquinone/menaquinone biosynthesis methyltransferase (TIGR01934; EC 2.1.1.-; HMM-score: 62.2)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone 3-demethylubiquinone-9 3-O-methyltransferase (TIGR01983; EC 2.1.1.64; HMM-score: 61.6)
    and 22 more
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Glutathione and analogs putative 4-mercaptohistidine N1-methyltranferase (TIGR04345; HMM-score: 50.8)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Chlorophyll and bacteriochlorphyll magnesium protoporphyrin O-methyltransferase (TIGR02021; EC 2.1.1.11; HMM-score: 40.2)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone demethylmenaquinone methyltransferase (TIGR02752; EC 2.1.1.163; HMM-score: 37)
    Cellular processes Cellular processes Toxin production and resistance tellurite resistance protein TehB (TIGR00477; HMM-score: 29.1)
    Unknown function Enzymes of unknown specificity tRNA (mo5U34)-methyltransferase (TIGR00452; EC 2.1.1.-; HMM-score: 28.8)
    Genetic information processing Protein fate Protein modification and repair protein-(glutamine-N5) methyltransferase, release factor-specific (TIGR03534; EC 2.1.1.-; HMM-score: 26.3)
    Metabolism Amino acid biosynthesis Aspartate family methionine biosynthesis protein MetW (TIGR02081; HMM-score: 25.5)
    Genetic information processing Protein synthesis tRNA and rRNA base modification 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG (TIGR00138; EC 2.1.1.170; HMM-score: 23.9)
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein L11 methyltransferase (TIGR00406; EC 2.1.1.-; HMM-score: 23.6)
    Unknown function Enzymes of unknown specificity putative methylase (TIGR00537; HMM-score: 22.9)
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific (TIGR03533; EC 2.1.1.-; HMM-score: 21.3)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit (TIGR02469; EC 2.1.1.132; HMM-score: 20.9)
    Genetic information processing Transcription RNA processing 3' terminal RNA ribose 2'-O-methyltransferase Hen1 (TIGR04074; EC 2.1.1.-; HMM-score: 19)
    Genetic information processing Protein synthesis tRNA and rRNA base modification 3' terminal RNA ribose 2'-O-methyltransferase Hen1 (TIGR04074; EC 2.1.1.-; HMM-score: 19)
    Genetic information processing Protein fate Protein modification and repair methyltransferase, HemK family (TIGR00536; HMM-score: 18.8)
    2-ketoarginine methyltransferase (TIGR04543; EC 2.1.1.243; HMM-score: 18.1)
    methyltransferase, Rta_06860 family (TIGR04290; EC 2.1.1.-; HMM-score: 17.9)
    Genetic information processing Protein synthesis tRNA and rRNA base modification ribosomal RNA small subunit methyltransferase A (TIGR00755; EC 2.1.1.182; HMM-score: 17.8)
    Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA (guanine-N(7)-)-methyltransferase (TIGR00091; EC 2.1.1.33; HMM-score: 17.5)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides putative sugar O-methyltransferase (TIGR04371; EC 2.1.1.-; HMM-score: 16.4)
    Genetic information processing Protein fate Protein modification and repair protein-L-isoaspartate O-methyltransferase (TIGR00080; EC 2.1.1.77; HMM-score: 13)
    Genetic information processing Protein synthesis tRNA and rRNA base modification 23S rRNA (uracil-5-)-methyltransferase RumA (TIGR00479; EC 2.1.1.-; HMM-score: 11.4)
  • TheSEED  :
    • Mobile element protein
  • PFAM:
    NADP_Rossmann (CL0063) Methyltransf_11; Methyltransferase domain (PF08241; HMM-score: 78.4)
    Methyltransf_25; Methyltransferase domain (PF13649; HMM-score: 71.8)
    Methyltransf_31; Methyltransferase domain (PF13847; HMM-score: 67.8)
    Methyltransf_12; Methyltransferase domain (PF08242; HMM-score: 67.6)
    Methyltransf_23; Methyltransferase domain (PF13489; HMM-score: 64)
    and 22 more
    Ubie_methyltran; ubiE/COQ5 methyltransferase family (PF01209; HMM-score: 44.9)
    MTS; Methyltransferase small domain (PF05175; HMM-score: 38.9)
    TehB; Tellurite resistance protein TehB (PF03848; HMM-score: 37)
    NodS; Nodulation protein S (NodS) (PF05401; HMM-score: 33.7)
    CMAS; Mycolic acid cyclopropane synthetase (PF02353; HMM-score: 32.9)
    Methyltransf_9; Protein of unknown function (DUF1698) (PF08003; HMM-score: 31.8)
    TPMT; Thiopurine S-methyltransferase (TPMT) (PF05724; HMM-score: 28)
    PrmA; Ribosomal protein L11 methyltransferase (PrmA) (PF06325; HMM-score: 27.5)
    GidB; rRNA small subunit methyltransferase G (PF02527; HMM-score: 24.9)
    DREV; DREV methyltransferase (PF05219; HMM-score: 21.2)
    Methyltransf_PK; AdoMet dependent proline di-methyltransferase (PF05891; HMM-score: 21.2)
    Methyltransf_32; Methyltransferase domain (PF13679; HMM-score: 19.1)
    MetW; Methionine biosynthesis protein MetW (PF07021; HMM-score: 17.6)
    Methyltransf_4; Putative methyltransferase (PF02390; HMM-score: 16.8)
    CheR; CheR methyltransferase, SAM binding domain (PF01739; HMM-score: 16.5)
    RrnaAD; Ribosomal RNA adenine dimethylase (PF00398; HMM-score: 15.9)
    Methyltransf_15; RNA cap guanine-N2 methyltransferase (PF09445; HMM-score: 14.9)
    NpmA; 16S rRNA (adenine(1408)-N(1))-methyltransferase (PF24675; HMM-score: 14.7)
    FtsJ; FtsJ-like methyltransferase (PF01728; HMM-score: 14.6)
    PCMT; Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) (PF01135; HMM-score: 14.3)
    no clan defined DNA_pol3_a_NI; DNA polymerase III polC-type N-terminus I (PF14480; HMM-score: 13.7)
    NADP_Rossmann (CL0063) AviRa; RRNA methyltransferase AviRa (PF11599; HMM-score: 11.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.1985
    • Cytoplasmic Membrane Score: 0.7646
    • Cell wall & surface Score: 0.002
    • Extracellular Score: 0.0349
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.006343
    • TAT(Tat/SPI): 0.000657
    • LIPO(Sec/SPII): 0.000815
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MNTIESQFDKVAEDYDFVNELLNDYSFFVSNMSPKKGRALDIGCGSGLLVEKLASYYDEVVGIDISNQMLDLAKSKRQLTNTVYLNMNAEQLNFNEKFDFIVSRTTFHHLDDIASVIQQMKELLNEEGRIVILDNVSEVETPPTYVYKLGAIQEFLPHCFKFGIKNAIRIYNHNTSKSWLEHLASDKYLSEQNYYDLYEKLLPGCQFHKMGWAMGVVWTK

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]