Jump to navigation
Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1953 [new locus tag: SA_RS11210 ]
- pan locus tag?: SAUPAN005452000
- symbol: tnpC
- pan gene symbol?: tnpC
- synonym:
- product: transposition regulatory protein tnpC
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1953 [new locus tag: SA_RS11210 ]
- symbol: tnpC
- product: transposition regulatory protein tnpC
- replicon: chromosome
- strand: -
- coordinates: 2201983..2202360
- length: 378
- essential: no DEG
⊟Accession numbers[edit | edit source]
- Gene ID: 1124854 NCBI
- RefSeq: NP_375258 NCBI
- BioCyc: see SA_RS11210
- MicrobesOnline: 104284 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGGATAAACAAGTTAGAAATACAACAGAAATTGTACGTTTGGCGAAGCAGAAATCAAAA
AAGACAAGGGAAAAAGTAGACAAAGCGATTTCTAAATTTTCGATTGAAGGTAAAGTTATT
AATTTTAATTCAATAGCAAAGGAAGCTAATGTTTCTAAATCATGGCTTTATAAGGAACAC
GATATTAGGCAAAGAATCGAATCCCTTCGTGAGCGTCAAATAACAGCAAATGTAGTCTCA
AAACCCAAGAAAAGTTCTCGTTCGGAGGAAATCCTTATTAAAACCTTAAAAAGAAGAGTA
ATGGAATTAGAAAAAGAAAATAAAAAATTACAGAACCAAATTCAAAAATTATATGGAGAT
CTGTATAATAAAGAATAA60
120
180
240
300
360
378
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1953 [new locus tag: SA_RS11210 ]
- symbol: TnpC
- description: transposition regulatory protein tnpC
- length: 125
- theoretical pI: 10.822
- theoretical MW: 14804.1
- GRAVY: -1.0384
⊟Function[edit | edit source]
- TIGRFAM: DNA 3'-phosphatase (TIGR01664; EC 3.1.3.32; HMM-score: 11.3)
- TheSEED :
- Mobile element protein
- PFAM: HTH (CL0123) DUF6262; Family of unknown function (DUF6262) (PF19776; HMM-score: 55.4)and 10 moreCoA-acyltrans (CL0149) Transferase; Transferase family (PF02458; HMM-score: 18.6)INO80_complex (CL0850) INO80F; INO80 complex subunit F (PF24245; HMM-score: 18)no clan defined HALZ; Homeobox associated leucine zipper (PF02183; HMM-score: 16.8)HTH (CL0123) LacI; Bacterial regulatory proteins, lacI family (PF00356; HMM-score: 16.2)bZIP (CL0018) bZIP_2; Basic region leucine zipper (PF07716; HMM-score: 15.5)TetR_C (CL0174) TetR_C_38; Tetracyclin repressor-like, C-terminal domain (PF19352; HMM-score: 13.1)FtsL (CL0225) ZapB; Cell division protein ZapB (PF06005; HMM-score: 12.8)P-loop_NTPase (CL0023) AAA_11; AAA domain (PF13086; HMM-score: 8.8)no clan defined DUF4337; Domain of unknown function (DUF4337) (PF14235; HMM-score: 8.3)FtsL (CL0225) DivIC; Septum formation initiator (PF04977; HMM-score: 7.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9889
- Cytoplasmic Membrane Score: 0.0072
- Cell wall & surface Score: 0.0018
- Extracellular Score: 0.0021
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.007501
- TAT(Tat/SPI): 0.000595
- LIPO(Sec/SPII): 0.001342
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MDKQVRNTTEIVRLAKQKSKKTREKVDKAISKFSIEGKVINFNSIAKEANVSKSWLYKEHDIRQRIESLRERQITANVVSKPKKSSRSEEILIKTLKRRVMELEKENKKLQNQIQKLYGDLYNKE
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
T Ito, Y Katayama, K Hiramatsu
Cloning and nucleotide sequence determination of the entire mec DNA of pre-methicillin-resistant Staphylococcus aureus N315.
Antimicrob Agents Chemother: 1999, 43(6);1449-58
[PubMed:10348769] [WorldCat.org] [DOI] (P p)