From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2124 [new locus tag: SA_RS12205 ]
  • pan locus tag?: SAUPAN005820000
  • symbol: fosB
  • pan gene symbol?: fosB
  • synonym:
  • product: fosfomycin resistance protein FosB

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA2124 [new locus tag: SA_RS12205 ]
  • symbol: fosB
  • product: fosfomycin resistance protein FosB
  • replicon: chromosome
  • strand: +
  • coordinates: 2389328..2389747
  • length: 420
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGTTAAAATCTATTAATCATATATGCTTTTCAGTCAGAAATTTAAACGATTCAATACAT
    TTTTATAGAGATATTTTACTTGGGAAATTGCTATTGACTGGTAAAAAAACTGCTTATTTT
    GAGCTTGCAGGCCTATGGATTGCTTTAAATGAAGAAAAAGATATACCACGTAATGAAATT
    CACTTTTCATATACACATATAGCTTTCACTATAGATGACAGCGAATTTAAATATTGGCAT
    CAGAGGTTAAAAGATAATAACGTGAATATTTTAGAAGGAAGAGTTAGAGATATTAGAGAT
    AGACAATCAATTTACTTTACTGACCCTGATGGTCATAAGCTAGAATTACATACTGGCACA
    CTTGAGAACAGATTAAATTATTATAAAGAGGCTAAACCACATATGACATTTTACAAATAA
    60
    120
    180
    240
    300
    360
    420

Protein[edit | edit source]

Protein Data Bank: 4NAY
Protein Data Bank: 4NAZ
Protein Data Bank: 4NB0
Protein Data Bank: 4NB1
Protein Data Bank: 4NB2

General[edit | edit source]

  • locus tag: SA2124 [new locus tag: SA_RS12205 ]
  • symbol: FosB
  • description: fosfomycin resistance protein FosB
  • length: 139
  • theoretical pI: 8.43846
  • theoretical MW: 16647.8
  • GRAVY: -0.591367

Function[edit | edit source]

  • reaction:
    EC 2.5.1.-?  ExPASy
  • TIGRFAM:
    Metabolism Energy metabolism Other lactoylglutathione lyase (TIGR00068; EC 4.4.1.5; HMM-score: 26.1)
    Metabolism Central intermediary metabolism Amino sugars lactoylglutathione lyase (TIGR00068; EC 4.4.1.5; HMM-score: 26.1)
    and 5 more
    Metabolism Energy metabolism Other catechol 2,3 dioxygenase (TIGR03211; EC 1.13.11.2; HMM-score: 19.9)
    methylmalonyl-CoA epimerase (TIGR03081; EC 5.1.99.1; HMM-score: 17.7)
    3,4-dihydroxyphenylacetate 2,3-dioxygenase (TIGR02295; EC 1.13.11.15; HMM-score: 17)
    Metabolism Energy metabolism Other 2,3-dihydroxybiphenyl 1,2-dioxygenase (TIGR03213; EC 1.13.11.39; HMM-score: 15.9)
    lactoylglutathione lyase family protein (TIGR03645; HMM-score: 12.7)
  • TheSEED:  
    Virulence, Disease and Defense Resistance to antibiotics and toxic compounds Fosfomycin resistance  Fosfomycin resistance protein FosB
  • PFAM:
    Glyoxalase (CL0104) Glyoxalase; Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily (PF00903; HMM-score: 50.6)
    and 1 more
    Glyoxalase_2; Glyoxalase-like domain (PF12681; HMM-score: 30.1)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors: Mg2+
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003307
    • TAT(Tat/SPI): 0.000405
    • LIPO(Sec/SPII): 0.000572
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MLKSINHICFSVRNLNDSIHFYRDILLGKLLLTGKKTAYFELAGLWIALNEEKDIPRNEIHFSYTHIAFTIDDSEFKYWHQRLKDNNVNILEGRVRDIRDRQSIYFTDPDGHKLELHTGTLENRLNYYKEAKPHMTFYK

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

  • fosB no polycistronic organisation predicted

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]