Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA2264 [new locus tag: SA_RS12995 ]
- pan locus tag?: SAUPAN006041000
- symbol: SA2264
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA2264 [new locus tag: SA_RS12995 ]
- symbol: SA2264
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2541721..2542131
- length: 411
- essential: no DEG
⊟Accession numbers[edit | edit source]
- Gene ID: 1125192 NCBI
- RefSeq: NP_375588 NCBI
- BioCyc: see SA_RS12995
- MicrobesOnline: 104614 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGTCGAAAAAGAAAATTTTAATATTAACTAGTATTATGTTAATCATATTAATTAGTGTT
GCAAGTATCTATTTTAAAATGAAATATGACGAAAAAGAAAAACAAAAATCAATTTATTAT
AAAGAACAACAAGCGCGCATTACACTTTATCTTAAGCATAATACTATAGAACCGAACACA
ATCAAATCTGTACATTTCACAAAATTGGAAACAAGTCCTATGGGAAGTGCTGTGATTGAA
GGTTACATAAATGAAAATAAAGAAGATGATTTTGTTGCCTATGCATCACCTGAAAATAAC
TTTCAATTTGTAGGTGATTTAATTAAAAGTGAAAGATTAAGTGAGTTACTAAAACCAGCG
CATCAATTAAAATCACCAGATGATATAAAAAAAGAACTAAATAAAAAGTAG60
120
180
240
300
360
411
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA2264 [new locus tag: SA_RS12995 ]
- symbol: SA2264
- description: hypothetical protein
- length: 136
- theoretical pI: 9.63777
- theoretical MW: 15786.3
- GRAVY: -0.466176
⊟Function[edit | edit source]
- TIGRFAM: Energy metabolism Electron transport ubiquinol oxidase, subunit II (TIGR01433; EC 1.10.3.-; HMM-score: 13.1)Transport and binding proteins Other efflux pump membrane protein (TIGR00998; HMM-score: 11.5)
- TheSEED :
- FIG01108221: hypothetical protein
- PFAM: no clan defined DUF1433; Protein of unknown function (DUF1433) (PF07252; HMM-score: 124.9)and 3 moreViral_Beta_CD; Viral Beta C/D like family (PF04530; HMM-score: 19.1)Sec66; Preprotein translocase subunit Sec66 (PF09802; HMM-score: 13.7)Holin-II (CL0563) Phage_holin_2_1; Bacteriophage P21 holin S (PF04971; HMM-score: 11.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0006
- Cytoplasmic Membrane Score: 0.6103
- Cell wall & surface Score: 0.0012
- Extracellular Score: 0.3879
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: 0
- N-terminally Anchored Score: 2
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.20685
- TAT(Tat/SPI): 0.001211
- LIPO(Sec/SPII): 0.102674
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSKKKILILTSIMLIILISVASIYFKMKYDEKEKQKSIYYKEQQARITLYLKHNTIEPNTIKSVHFTKLETSPMGSAVIEGYINENKEDDFVAYASPENNFQFVGDLIKSERLSELLKPAHQLKSPDDIKKELNKK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]