From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2264 [new locus tag: SA_RS12995 ]
  • pan locus tag?: SAUPAN006041000
  • symbol: SA2264
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA2264 [new locus tag: SA_RS12995 ]
  • symbol: SA2264
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2541721..2542131
  • length: 411
  • essential: no DEG

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGTCGAAAAAGAAAATTTTAATATTAACTAGTATTATGTTAATCATATTAATTAGTGTT
    GCAAGTATCTATTTTAAAATGAAATATGACGAAAAAGAAAAACAAAAATCAATTTATTAT
    AAAGAACAACAAGCGCGCATTACACTTTATCTTAAGCATAATACTATAGAACCGAACACA
    ATCAAATCTGTACATTTCACAAAATTGGAAACAAGTCCTATGGGAAGTGCTGTGATTGAA
    GGTTACATAAATGAAAATAAAGAAGATGATTTTGTTGCCTATGCATCACCTGAAAATAAC
    TTTCAATTTGTAGGTGATTTAATTAAAAGTGAAAGATTAAGTGAGTTACTAAAACCAGCG
    CATCAATTAAAATCACCAGATGATATAAAAAAAGAACTAAATAAAAAGTAG
    60
    120
    180
    240
    300
    360
    411

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA2264 [new locus tag: SA_RS12995 ]
  • symbol: SA2264
  • description: hypothetical protein
  • length: 136
  • theoretical pI: 9.63777
  • theoretical MW: 15786.3
  • GRAVY: -0.466176

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Energy metabolism Electron transport ubiquinol oxidase, subunit II (TIGR01433; EC 1.10.3.-; HMM-score: 13.1)
    Metabolism Transport and binding proteins Other efflux pump membrane protein (TIGR00998; HMM-score: 11.5)
  • TheSEED:  
    FIG01108221: hypothetical protein
  • PFAM:
    no clan defined DUF1433; Protein of unknown function (DUF1433) (PF07252; HMM-score: 124.9)
    and 2 more
    Viral_Beta_CD; Viral Beta C/D like family (PF04530; HMM-score: 19.1)
    Sec66; Preprotein translocase subunit Sec66 (PF09802; HMM-score: 13.7)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0
    • N-terminally Anchored Score: 2
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.20685
    • TAT(Tat/SPI): 0.001211
    • LIPO(Sec/SPII): 0.102674
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MSKKKILILTSIMLIILISVASIYFKMKYDEKEKQKSIYYKEQQARITLYLKHNTIEPNTIKSVHFTKLETSPMGSAVIEGYINENKEDDFVAYASPENNFQFVGDLIKSERLSELLKPAHQLKSPDDIKKELNKK

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

  • SA2264 no polycistronic organisation predicted

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]