From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2280 [new locus tag: SA_RS13080 ]
  • pan locus tag?: SAUPAN006092000
  • symbol: SA2280
  • pan gene symbol?: scrA
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA2280 [new locus tag: SA_RS13080 ]
  • symbol: SA2280
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2557087..2557353
  • length: 267
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAAAGGCTCTAAACAAATACTTTTGATTATGGGCATTATATCTCTTATTGTTTTATTT
    ATTTTTACACTATTCATCATGGCACAATATGCAAAACATTATGAACAAAAATCCGACAGT
    TCCAACGCACATACTTTAAACTCATCATCAGCCATAATTGAGCAACATACTATGTCGAAT
    TTAGCGTCTCTAGATTTATACGCTCCTGTTCGTAACATTACTTCTAGTCGTGATATTCAT
    CCCATTTATTTCATGACAAAAGATTAA
    60
    120
    180
    240
    267


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA2280 [new locus tag: SA_RS13080 ]
  • symbol: SA2280
  • description: hypothetical protein
  • length: 88
  • theoretical pI: 8.94062
  • theoretical MW: 9964.55
  • GRAVY: 0.176136

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • FIG01107928: hypothetical protein
  • PFAM:
    TSPAN_4TM-like (CL0347) DUF4064; Protein of unknown function (DUF4064) (PF13273; HMM-score: 17.1)
    no clan defined SelK_SelG; Selenoprotein SelK_SelG (PF10961; HMM-score: 15.3)
    and 1 more
    Vpu; Vpu protein (PF00558; HMM-score: 12.5)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0007
    • Cytoplasmic Membrane Score: 0.8903
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.1089
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0.5
    • N-terminally Anchored Score: 7
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.170297
    • TAT(Tat/SPI): 0.002748
    • LIPO(Sec/SPII): 0.027568
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MKGSKQILLIMGIISLIVLFIFTLFIMAQYAKHYEQKSDSSNAHTLNSSSAIIEQHTMSNLASLDLYAPVRNITSSRDIHPIYFMTKD

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • data available for JSNZ

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]