Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA2280 [new locus tag: SA_RS13080 ]
- pan locus tag?: SAUPAN006092000
- symbol: SA2280
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA2280 [new locus tag: SA_RS13080 ]
- symbol: SA2280
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 2557087..2557353
- length: 267
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1125208 NCBI
- RefSeq: NP_375604 NCBI
- BioCyc: see SA_RS13080
- MicrobesOnline: 104630 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAAAGGCTCTAAACAAATACTTTTGATTATGGGCATTATATCTCTTATTGTTTTATTT
ATTTTTACACTATTCATCATGGCACAATATGCAAAACATTATGAACAAAAATCCGACAGT
TCCAACGCACATACTTTAAACTCATCATCAGCCATAATTGAGCAACATACTATGTCGAAT
TTAGCGTCTCTAGATTTATACGCTCCTGTTCGTAACATTACTTCTAGTCGTGATATTCAT
CCCATTTATTTCATGACAAAAGATTAA60
120
180
240
267
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA2280 [new locus tag: SA_RS13080 ]
- symbol: SA2280
- description: hypothetical protein
- length: 88
- theoretical pI: 8.94062
- theoretical MW: 9964.55
- GRAVY: 0.176136
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0007
- Cytoplasmic Membrane Score: 0.8903
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.1089
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: 0.5
- N-terminally Anchored Score: 7
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.170297
- TAT(Tat/SPI): 0.002748
- LIPO(Sec/SPII): 0.027568
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKGSKQILLIMGIISLIVLFIFTLFIMAQYAKHYEQKSDSSNAHTLNSSSAIIEQHTMSNLASLDLYAPVRNITSSRDIHPIYFMTKD
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.