From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2419 [new locus tag: SA_RS13870 ]
  • pan locus tag?: SAUPAN006340000
  • symbol: SA2419
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA2419 [new locus tag: SA_RS13870 ]
  • symbol: SA2419
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2714613..2714813
  • length: 201
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGATACTAGTAATGTTATCTCCATTATTAATCATATTCTTTATAGTGTTGTCTATTTTA
    GAGGAGCGTAAACGTACGAAGAAAAAGCAACTCGAGAAAGAAAAAGCAAATACACTAAAT
    CAAAATACAAATGACACGGAAAGTTCAAATCAAGAGCCGTCATTGCAGCAGACTAAAGAA
    CAAAAAGATAACAAAGGATAA
    60
    120
    180
    201

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SA2419 [new locus tag: SA_RS13870 ]
  • symbol: SA2419
  • description: hypothetical protein
  • length: 66
  • theoretical pI: 9.91647
  • theoretical MW: 7673.81
  • GRAVY: -0.793939

⊟Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Adaptations to atypical conditions phage shock protein B (TIGR02976; HMM-score: 13.9)
    Cellular processes Cellular processes Sporulation and germination stage III sporulation protein AF (TIGR02896; HMM-score: 13.5)
    and 1 more
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-galactonate transporter (TIGR00893; HMM-score: 10.1)
  • TheSEED  :
    • FIG01108353: hypothetical protein
  • PFAM:
    no clan defined DUF4834; Domain of unknown function (DUF4834) (PF16118; HMM-score: 21.7)
    DUF1510; Protein of unknown function (DUF1510) (PF07423; HMM-score: 19.9)
    and 17 more
    Di19_C; Stress-induced protein Di19, C-terminal (PF14571; HMM-score: 16.8)
    TMEM156; TMEM156 protein family (PF15106; HMM-score: 15.9)
    Cadherin_C_2; Cadherin cytoplasmic C-terminal (PF16492; HMM-score: 15.8)
    OSTbeta; Organic solute transporter subunit beta protein (PF15048; HMM-score: 15.4)
    Transporter (CL0375) Connexin; Connexin (PF00029; HMM-score: 14.8)
    no clan defined EphA2_TM; Ephrin type-A receptor 2 transmembrane domain (PF14575; HMM-score: 14)
    YajC; Preprotein translocase subunit (PF02699; HMM-score: 13.4)
    DUF4725; Domain of unknown function (DUF4725) (PF15854; HMM-score: 13.1)
    GRP; Glycine rich protein family (PF07172; HMM-score: 13)
    Ctr; Ctr copper transporter family (PF04145; HMM-score: 12.9)
    Ninjurin; Ninjurin (PF04923; HMM-score: 12.6)
    CLN3; CLN3 protein (PF02487; HMM-score: 12.2)
    MotB_plug; Membrane MotB of proton-channel complex MotA/MotB (PF13677; HMM-score: 12.1)
    GPCR_A (CL0192) SID-1_RNA_chan; dsRNA-gated channel SID-1 (PF13965; HMM-score: 11.4)
    7tm_1; 7 transmembrane receptor (rhodopsin family) (PF00001; HMM-score: 11.2)
    no clan defined OAD_gamma; Oxaloacetate decarboxylase, gamma chain (PF04277; HMM-score: 11.2)
    TMEM154; TMEM154 protein family (PF15102; HMM-score: 11.2)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0
    • N-terminally Anchored Score: 4
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.266907
    • TAT(Tat/SPI): 0.001814
    • LIPO(Sec/SPII): 0.194897
  • predicted transmembrane helices (TMHMM): 1

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MILVMLSPLLIIFFIVLSILEERKRTKKKQLEKEKANTLNQNTNDTESSNQEPSLQQTKEQKDNKG

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SA2419&oldid=84089"