Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA2419 [new locus tag: SA_RS13870 ]
- pan locus tag?: SAUPAN006340000
- symbol: SA2419
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA2419 [new locus tag: SA_RS13870 ]
- symbol: SA2419
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2714613..2714813
- length: 201
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1125348 NCBI
- RefSeq: NP_375745 NCBI
- BioCyc: see SA_RS13870
- MicrobesOnline: 104771 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGATACTAGTAATGTTATCTCCATTATTAATCATATTCTTTATAGTGTTGTCTATTTTA
GAGGAGCGTAAACGTACGAAGAAAAAGCAACTCGAGAAAGAAAAAGCAAATACACTAAAT
CAAAATACAAATGACACGGAAAGTTCAAATCAAGAGCCGTCATTGCAGCAGACTAAAGAA
CAAAAAGATAACAAAGGATAA60
120
180
201
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA2419 [new locus tag: SA_RS13870 ]
- symbol: SA2419
- description: hypothetical protein
- length: 66
- theoretical pI: 9.91647
- theoretical MW: 7673.81
- GRAVY: -0.793939
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Adaptations to atypical conditions phage shock protein B (TIGR02976; HMM-score: 13.9)Cellular processes Sporulation and germination stage III sporulation protein AF (TIGR02896; HMM-score: 13.5)and 1 moreTransport and binding proteins Carbohydrates, organic alcohols, and acids D-galactonate transporter (TIGR00893; HMM-score: 10.1)
- TheSEED :
- FIG01108353: hypothetical protein
- PFAM: no clan defined DUF4834; Domain of unknown function (DUF4834) (PF16118; HMM-score: 21.2)TMEM154; TMEM154 protein family (PF15102; HMM-score: 18.9)TMEM156; TMEM156 protein family (PF15106; HMM-score: 17.2)and 19 moreTransporter (CL0375) Connexin; Connexin (PF00029; HMM-score: 16.6)no clan defined Cadherin_C_2; Cadherin cytoplasmic C-terminal (PF16492; HMM-score: 16.2)TPR (CL0020) DUF6377; Domain of unknown function (DUF6377) (PF19904; HMM-score: 15.5)no clan defined GPR15L; G-protein coupled receptor ligand 15 (PF15854; HMM-score: 15.2)Ctr; Ctr copper transporter family (PF04145; HMM-score: 15.1)DUF6724; Family of unknown function (DUF6724) (PF20485; HMM-score: 14.7)PFF1_TM; Vacuolar membrane protease, transmembrane domain (PF22251; HMM-score: 14.4)OSTbeta; Organic solute transporter subunit beta protein (PF15048; HMM-score: 13.5)DUF6249; Domain of unknown function (DUF6249) (PF19762; HMM-score: 13.1)GRP; Glycine rich protein family (PF07172; HMM-score: 12.7)YajC; Preprotein translocase subunit (PF02699; HMM-score: 12.4)MFS (CL0015) SLC52_ribofla_tr; Solute carrier family 52, riboflavin transporter (PF06237; HMM-score: 12.4)CLN3; CLN3 protein (PF02487; HMM-score: 12.2)no clan defined MotB_plug; Membrane MotB of proton-channel complex MotA/MotB (PF13677; HMM-score: 12.1)Piezo_TM1-24; Piezo TM1-24 (PF24871; HMM-score: 11.8)OAD_gamma; Oxaloacetate decarboxylase, gamma chain (PF04277; HMM-score: 11.3)GPCR_A (CL0192) SID-1_RNA_chan; dsRNA-gated channel SID-1 (PF13965; HMM-score: 10.8)no clan defined DUF6720; Family of unknown function (DUF6720) (PF20480; HMM-score: 10.1)Motilin_ghrelin; Motilin/ghrelin (PF04644; HMM-score: 8.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9971
- Cell wall & surface Score: 0
- Extracellular Score: 0.0029
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: 0
- N-terminally Anchored Score: 4
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.266907
- TAT(Tat/SPI): 0.001814
- LIPO(Sec/SPII): 0.194897
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MILVMLSPLLIIFFIVLSILEERKRTKKKQLEKEKANTLNQNTNDTESSNQEPSLQQTKEQKDNKG
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]