Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0057 [new locus tag: SACOL_RS00295 ]
- pan locus tag?: SAUPAN000831000
- symbol: SACOL0057
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0057 [new locus tag: SACOL_RS00295 ]
- symbol: SACOL0057
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 68407..68499
- length: 93
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236894 NCBI
- RefSeq: YP_184963 NCBI
- BioCyc: see SACOL_RS00295
- MicrobesOnline: 911538 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61TTGACAAAAAATAGTAAATATACCAATGAAGTTTCAAAAGAACAATTCCAAGAAATTGAG
AATGTAAATAATAAGGTCAAAGAATTTTATTAA60
93
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0057 [new locus tag: SACOL_RS00295 ]
- symbol: SACOL0057
- description: hypothetical protein
- length: 30
- theoretical pI: 6.69504
- theoretical MW: 3670.04
- GRAVY: -1.41667
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM:
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 0.24
- Cytoplasmic Membrane Score: 0.05
- Cellwall Score: 0.8
- Extracellular Score: 8.91
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.7054
- Cytoplasmic Membrane Score: 0.0022
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.2923
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.12863
- TAT(Tat/SPI): 0.036874
- LIPO(Sec/SPII): 0.044502
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTKNSKYTNEVSKEQFQEIENVNNKVKEFY
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]