Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0285 [new locus tag: SACOL_RS01445 ]
- pan locus tag?: SAUPAN001197000
- symbol: SACOL0285
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0285 [new locus tag: SACOL_RS01445 ]
- symbol: SACOL0285
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 325614..325832
- length: 219
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236657 NCBI
- RefSeq: YP_185180 NCBI
- BioCyc:
- MicrobesOnline: 911758 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGGAAAACCAAAAACAAGGCAATGGCTTAAAAATTGCAACATGGGTATTTATTGTATTA
ACAGTAGTTACACCGCTATTTGGTATTGGAAGTATTGTTTGTAGTATTAATTATAAAAAA
TACGATGCTGAAAAAGGTTCGAAGTTATTGCAAATTGCAATTATCGTAACAATAATTGCT
TTTGTTTTAAATTTATTAGCATATTTAGGTTTAAGATAA60
120
180
219
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0285 [new locus tag: SACOL_RS01445 ]
- symbol: SACOL0285
- description: hypothetical protein
- length: 72
- theoretical pI: 9.97598
- theoretical MW: 7926.51
- GRAVY: 0.795833
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- FIG01108015: hypothetical protein
- PFAM: no clan defined DUF4293; Domain of unknown function (DUF4293) (PF14126; HMM-score: 18.3)AWPM-19; AWPM-19-like family (PF05512; HMM-score: 16.5)and 3 moreRTA1; RTA1 like protein (PF04479; HMM-score: 13.6)DUF4282; Domain of unknown function (DUF4282) (PF14110; HMM-score: 13)C_Lectin (CL0056) Chordopox_A33R; Chordopoxvirus A33R protein (PF05966; HMM-score: 12.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.026764
- TAT(Tat/SPI): 0.000431
- LIPO(Sec/SPII): 0.187649
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MENQKQGNGLKIATWVFIVLTVVTPLFGIGSIVCSINYKKYDAEKGSKLLQIAIIVTIIAFVLNLLAYLGLR
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- SACOL0285 no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]