From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0434 [new locus tag: SACOL_RS02185 ]
  • pan locus tag?: SAUPAN001908000
  • symbol: SACOL0434
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0434 [new locus tag: SACOL_RS02185 ]
  • symbol: SACOL0434
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 440861..441064
  • length: 204
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGGCGTCAAAATATGGAATAAATGATATAGTAGAAATGAAAAAACAACATGCGTGTGGA
    ACAAACCGTTTTAAGATTATTAGAATGGGTGCAGACATAAGAATTAAATGTGAAAATTGT
    CAAAGAAGTATTATGATTCCACGTCAAACGTTTGATAAAAAACTTAAAAAAATCATCGAA
    TCTCATGATGATACACAAAGATAG
    60
    120
    180
    204


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL0434 [new locus tag: SACOL_RS02185 ]
  • symbol: SACOL0434
  • description: hypothetical protein
  • length: 67
  • theoretical pI: 10.3542
  • theoretical MW: 7882.25
  • GRAVY: -0.753731

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • FIG01108061: hypothetical protein
  • PFAM:
    SH3 (CL0010) DUF951; Bacterial protein of unknown function (DUF951) (PF06107; HMM-score: 98.2)
    and 1 more
    Kinetochore (CL0724) Ctf19_RWD1; Ctf19, first RWD domain (PF22463; HMM-score: 13.5)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9956
    • Cytoplasmic Membrane Score: 0.0004
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0039
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.012365
    • TAT(Tat/SPI): 0.000626
    • LIPO(Sec/SPII): 0.002649
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MASKYGINDIVEMKKQHACGTNRFKIIRMGADIRIKCENCQRSIMIPRQTFDKKLKKIIESHDDTQR

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1]
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]