Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0444 [new locus tag: SACOL_RS02240 ]
- pan locus tag?: SAUPAN001971000
- symbol: SACOL0444
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0444 [new locus tag: SACOL_RS02240 ]
- symbol: SACOL0444
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 447487..448059
- length: 573
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236487 NCBI
- RefSeq: YP_185334 NCBI
- BioCyc:
- MicrobesOnline: 911914 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541ATGAAATTAAAATCATTAGCAGTGTTATCAATGTCAGCGGTGGTGCTTACTGCATGTGGC
AATGATACTCCAAAAGATGAAACAAAATCAACAGAGTCAAATACTAATCAAGACACTAAT
ACAACAAAAGATGTTATTGCTTTAAAAGATGTTAAAACAAGCCCAGAAGATGCTGTGAAA
AAAGCTGAAGAAACTTACAAAGGCCAAAAGTTGAAAGGAATTTCATTTGAAAATTCTAAT
GGTGAATGGGCTTATAAAGTGACGCAACAAAAATCTGGTGAAGAGTCAGAAGTACTTGTT
GCTGATAAAAATAAAAAAGTGATTAACAAAAAGACTGAAAAAGAAGATACAATGAATGAA
AATGATAACTTTAAATATAGCGATGCTATAGATTACAAAAAAGCCATTAAAGAAGGACAA
AAAGAATTTGATGGTGATATTAAAGAATGGTCACTTGAAAAAGATGATGGCAAACTTGTT
TACAATATCGATTTGAAAAAAGGTAATAAAAAACAAGAAGTTACTGTTGATGCTAAGAAC
GGTAAAGTATTAAAGAGTGAGCAAGATCACTAA60
120
180
240
300
360
420
480
540
573
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0444 [new locus tag: SACOL_RS02240 ]
- symbol: SACOL0444
- description: hypothetical protein
- length: 190
- theoretical pI: 5.53203
- theoretical MW: 21305.6
- GRAVY: -1.10474
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: FIG01108790: hypothetical protein
- PFAM: PepSY (CL0320) PepSY; Peptidase propeptide and YPEB domain (PF03413; HMM-score: 58)and 2 morePepSY_2; Peptidase propeptide and YPEB domain (PF13670; HMM-score: 16.8)no clan defined NusG_II; NusG domain II (PF07009; HMM-score: 9)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 3.33
- Cellwall Score: 3.33
- Extracellular Score: 3.33
- Internal Helices: 0
- LocateP: Lipid anchored
- Prediction by SwissProt Classification: Extracellular
- Pathway Prediction: Sec-(SPII)
- Intracellular possibility: -0.33
- Signal peptide possibility: 1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: VVLTACG
- SignalP: Signal peptide LIPO(Sec/SPII) length 18 aa
- SP(Sec/SPI): 0.000422
- TAT(Tat/SPI): 0.000043
- LIPO(Sec/SPII): 0.999392
- Cleavage Site: CS pos: 18-19. LTA-CG. Pr: 0.9998
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKLKSLAVLSMSAVVLTACGNDTPKDETKSTESNTNQDTNTTKDVIALKDVKTSPEDAVKKAEETYKGQKLKGISFENSNGEWAYKVTQQKSGEESEVLVADKNKKVINKKTEKEDTMNENDNFKYSDAIDYKKAIKEGQKEFDGDIKEWSLEKDDGKLVYNIDLKKGNKKQEVTVDAKNGKVLKSEQDH
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- SACOL0444 no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator: SigB* (activation) regulon
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: 7.36 h [8]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
J Proteome Res: 2010, 9(3);1579-90
[PubMed:20108986] [WorldCat.org] [DOI] (I p) - ↑ Annette Dreisbach, Kristina Hempel, Girbe Buist, Michael Hecker, Dörte Becher, Jan Maarten van Dijl
Profiling the surfacome of Staphylococcus aureus.
Proteomics: 2010, 10(17);3082-96
[PubMed:20662103] [WorldCat.org] [DOI] (I p) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p) - ↑ Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
The sigmaB regulon in Staphylococcus aureus and its regulation.
Int J Med Microbiol: 2006, 296(4-5);237-58
[PubMed:16644280] [WorldCat.org] [DOI] (P p) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]