Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0542 [new locus tag: SACOL_RS02770 ]
- pan locus tag?: SAUPAN002238000
- symbol: SACOL0542
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0542 [new locus tag: SACOL_RS02770 ]
- symbol: SACOL0542
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 549748..549879
- length: 132
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238520 NCBI
- RefSeq: YP_185430 NCBI
- BioCyc: see SACOL_RS02770
- MicrobesOnline: 912014 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121TTGCGTTTGAATGATGCTCGTATTTTTGAAGTAAGAAAAAAGTTGTTTTTAAAATTACAA
CGAATTAAAAACAATGCCTTTTATATGTTGAAAGAGTATTGCAGATTAAATTATAATAAT
GACGAAGTGTAA60
120
132
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0542 [new locus tag: SACOL_RS02770 ]
- symbol: SACOL0542
- description: hypothetical protein
- length: 43
- theoretical pI: 10.2905
- theoretical MW: 5412.35
- GRAVY: -0.683721
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for NCTC8325, USA300_FPR3757
- PFAM:
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.143122
- TAT(Tat/SPI): 0.002097
- LIPO(Sec/SPII): 0.009878
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRLNDARIFEVRKKLFLKLQRIKNNAFYMLKEYCRLNYNNDEV
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization: Cytoplasmic [1]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e)
⊟Relevant publications[edit | edit source]