From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0618 [new locus tag: SACOL_RS03195 ]
  • pan locus tag?: SAUPAN002348000
  • symbol: SACOL0618
  • pan gene symbol?: hxlB
  • synonym:
  • product: SIS domain-containing protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0618 [new locus tag: SACOL_RS03195 ]
  • symbol: SACOL0618
  • product: SIS domain-containing protein
  • replicon: chromosome
  • strand: +
  • coordinates: 650992..651540
  • length: 549
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGGCTAAATTTAGTGACTATCAATTAATTCTAGATGAATTAAAGATGACTTTGTCACAT
    GTTGAAGCGGATGAGTTTTCAACTTTTGCATCCAAAATACTACATGCTGAACATATATTT
    GTAGCTGGCAAAGGACGTTCAGGATTCGTGGCGAATAGTTTTGCAATGCGCTTAAATCAG
    CTCGGCAAACAGGCACATGTTGTTGGAGAATCAACGACACCTGCGATTAAGTCGAATGAT
    GTATTTGTAATTATCTCTGGTTCAGGTTCCACGGAACATTTAAGATTATTAGCAGACAAA
    GCAAAATCAGTAGGTGCTGACATCGTATTAATTACTACAAATAAAGATTCTGCAATAGGC
    AATCTAGCTGGGACGAACATCGTTTTGCCTGCAGGTACAAAATATGATGAACAAGGCTCG
    GCACAACCATTAGGAAGTTTGTTTGAACAAGCATCTCAATTATTTTTAGATAGTGTTGTA
    ATGGGATTGATGACTGAAATGAATGTTACGGAACAAACGATGCAACAAAATCATGCTAAT
    TTAGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    549

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0618 [new locus tag: SACOL_RS03195 ]
  • symbol: SACOL0618
  • description: SIS domain-containing protein
  • length: 182
  • theoretical pI: 5.19307
  • theoretical MW: 19558.1
  • GRAVY: -0.00274725

Function[edit | edit source]

  • TIGRFAM:
    6-phospho 3-hexuloisomerase (TIGR03127; EC 5.3.-.-; HMM-score: 226.1)
    and 6 more
    Metabolism Energy metabolism Sugars sugar isomerase, KpsF/GutQ family (TIGR00393; HMM-score: 29.7)
    Cell structure Cell envelope Biosynthesis and degradation of murein sacculus and peptidoglycan N-acetylmuramic acid 6-phosphate etherase (TIGR00274; EC 4.2.1.126; HMM-score: 23.2)
    Cell structure Cell envelope Biosynthesis and degradation of murein sacculus and peptidoglycan glutamine-fructose-6-phosphate transaminase (isomerizing) (TIGR01135; EC 2.6.1.16; HMM-score: 20)
    Metabolism Central intermediary metabolism Amino sugars glutamine-fructose-6-phosphate transaminase (isomerizing) (TIGR01135; EC 2.6.1.16; HMM-score: 20)
    bifunctional phosphoglucose/phosphomannose isomerase (TIGR02128; EC 5.3.1.9; HMM-score: 18)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Purine ribonucleotide biosynthesis phosphoribosylglycinamide formyltransferase (TIGR00639; EC 2.1.2.2; HMM-score: 12.2)
  • TheSEED:  
    Carbohydrates One-carbon Metabolism Formaldehyde assimilation: Ribulose monophosphate pathway  6-phospho-3-hexuloisomerase
    and 1 more
    6-phospho-3-hexuloisomerase (EC 5.3.1.27)
  • PFAM:
    SIS (CL0067) SIS; SIS domain (PF01380; HMM-score: 67.6)
    and 2 more
    SIS_2; SIS domain (PF13580; HMM-score: 24.6)
    no clan defined Formyl_trans_N; Formyl transferase (PF00551; HMM-score: 14.5)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003823
    • TAT(Tat/SPI): 0.000787
    • LIPO(Sec/SPII): 0.000218
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MAKFSDYQLILDELKMTLSHVEADEFSTFASKILHAEHIFVAGKGRSGFVANSFAMRLNQLGKQAHVVGESTTPAIKSNDVFVIISGSGSTEHLRLLADKAKSVGADIVLITTNKDSAIGNLAGTNIVLPAGTKYDEQGSAQPLGSLFEQASQLFLDSVVMGLMTEMNVTEQTMQQNHANLE

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1] [2] [3]
    quantitative data / protein copy number per cell: 734 [4]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: RpoF* (activation) regulon
    RpoF(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation [5]   other strains

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: 29.99 h [6]

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  5. Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
    The sigmaB regulon in Staphylococcus aureus and its regulation.
    Int J Med Microbiol: 2006, 296(4-5);237-58
    [PubMed:16644280] [WorldCat.org] [DOI] (P p)
  6. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]