From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0714 [new locus tag: SACOL_RS03675 ]
  • pan locus tag?: SAUPAN002536000
  • symbol: SACOL0714
  • pan gene symbol?:
  • synonym:
  • product: acetyltransferase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0714 [new locus tag: SACOL_RS03675 ]
  • symbol: SACOL0714
  • product: acetyltransferase
  • replicon: chromosome
  • strand: -
  • coordinates: 738930..739436
  • length: 507
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGGCCCATATTATACGTAGAGTTAGTATCAAAGATGTAGAAAATTTCATTTCAATGTTA
    GCGAACATATACGACGAATCTCCGTATATGTTCTACACACCAGGAGAATATGATCCTAGC
    GTCACATCGGCTAGTAAACAATTAGAAGAATATATCACTTCTCCGCATAAAGTCATCTTC
    GTTGCTGAAAGTGATGAACAACTCGTTGGCTTTGCCTTTGTTAATACGACACCATTTCAA
    CGCATTAAACATGTTGCTAAAATTGATTTAGGTGTAAAGAAATTATATCAACATCGTGGA
    ATTGGCCAAGCACTTCTTGATGCCATTATGGCTTGGTGTTTAAACAATCAAATACACCGA
    ATTGAAGCAAATGTACCACTCAATAACCAACCTGCCCTCGAGCTTTTTAAAAGTGCCGAT
    TTTCAAATCGAAGGCGTTTTAAAAGATAAGTTATTTATCGATGGTAAATATTATGATGAC
    TATATGATGGCTAAAATTCTTAATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    507

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0714 [new locus tag: SACOL_RS03675 ]
  • symbol: SACOL0714
  • description: acetyltransferase
  • length: 168
  • theoretical pI: 6.0027
  • theoretical MW: 19279.1
  • GRAVY: -0.129167

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal-protein-alanine acetyltransferase (TIGR01575; EC 2.3.1.128; HMM-score: 51.8)
    and 4 more
    UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine N-acetyltransferase (TIGR03585; EC 2.3.1.202; HMM-score: 39.7)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Glutathione and analogs mycothiol synthase (TIGR03448; EC 2.3.1.189; HMM-score: 22.1)
    Cellular processes Cellular processes Adaptations to atypical conditions diaminobutyrate acetyltransferase (TIGR02406; EC 2.3.1.178; HMM-score: 20.7)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides TDP-D-fucosamine acetyltransferase (TIGR02382; HMM-score: 18.6)
  • TheSEED  :
    • Acetyltransferase GNAT family
  • PFAM:
    Acetyltrans (CL0257) Acetyltransf_1; Acetyltransferase (GNAT) family (PF00583; HMM-score: 59.5)
    Acetyltransf_4; Acetyltransferase (GNAT) domain (PF13420; HMM-score: 56.2)
    and 9 more
    Acetyltransf_7; Acetyltransferase (GNAT) domain (PF13508; HMM-score: 45)
    Acetyltransf_10; Acetyltransferase (GNAT) domain (PF13673; HMM-score: 37.2)
    Acetyltransf_3; Acetyltransferase (GNAT) domain (PF13302; HMM-score: 26)
    Acetyltransf_8; Acetyltransferase (GNAT) domain (PF13523; HMM-score: 17.7)
    Acetyltransf_18; Acetyltransferase (GNAT) domain (PF18014; HMM-score: 14.8)
    PanZ; Acetyltransferase (GNAT) domain, PanZ (PF12568; HMM-score: 14.5)
    FR47; FR47-like protein (PF08445; HMM-score: 13.4)
    Acetyltransf_9; Acetyltransferase (GNAT) domain (PF13527; HMM-score: 12.8)
    no clan defined Hypoth_Ymh; Protein of unknown function (Hypoth_ymh) (PF09509; HMM-score: 12.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9308
    • Cytoplasmic Membrane Score: 0.0121
    • Cell wall & surface Score: 0.0031
    • Extracellular Score: 0.0541
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003266
    • TAT(Tat/SPI): 0.000479
    • LIPO(Sec/SPII): 0.000472
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MAHIIRRVSIKDVENFISMLANIYDESPYMFYTPGEYDPSVTSASKQLEEYITSPHKVIFVAESDEQLVGFAFVNTTPFQRIKHVAKIDLGVKKLYQHRGIGQALLDAIMAWCLNNQIHRIEANVPLNNQPALELFKSADFQIEGVLKDKLFIDGKYYDDYMMAKILN

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2] [3]
  • quantitative data / protein copy number per cell: 151 [4]
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: 54.26 h [5]

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  5. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]