From AureoWiki
Jump to navigation Jump to search
Pangenome04-0298108BA0217611819-97685071193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0896 [new locus tag: SACOL_RS04600 ]
  • pan locus tag?: SAUPAN002856000
  • symbol: SACOL0896
  • pan gene symbol?:
  • synonym:
  • product: pathogenicity island protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0896 [new locus tag: SACOL_RS04600 ]
  • symbol: SACOL0896
  • product: pathogenicity island protein
  • replicon: chromosome
  • strand: +
  • coordinates: 909068..909937
  • length: 870
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGAATGAAATTAAATTGAAATATGATACGCAAGTTTCGGTGGTACATTATGAAAGTTTA
    GACTCACGTTCATTTAAGAGCTTTTCAATGCCTAAATGGAGTAAGTTGGTTAATAAACTG
    TCTGTGCCTATAGAAGCAAATTATAAGTATGCACGTGGTGTTGCTGTATATGGTGATATT
    AAAGACAATACAAATGATCATGGTGAAATTATCAAAAAGCATCGAAACGATAAAAATGTC
    ATATATAGAAATGTGATTGTACTTGATTACGATGAAATAAATGATGTAAAACAACTACAT
    GACGCAATCAGCTCAGTTTTAAGCAGTGTTGCATGGTATTGGCACACATCGTTTAGCCAT
    ACAACTGAACAAGCTAGAATACGCTTGTATATCCCTCTAAATGAGCGAATAAGTGCAGAT
    GATTATCGTAAATATACAAAAGTATTAGCAAATAAAATTGGCCATAAAGTGGATGAAGGT
    TCGTATCAGCCAAGTAGATGTTTTGCGTTACCAGTTATTCAAAAAGGACACATATTTATT
    AAGCGAGTGAATGACTGTCCAATTATGGATGTTGATATGCTCGAACAGTGGTCAAAGGAG
    TATAAACAATCAAATGGTAGTCCTAATATCAAAGGGTACACACGACGTGATAGTGCGTAT
    TGGCGAGATATAGCTTTTGGTGTAAGTGAGGGAGAGCGCAATTCAACATTGGCTTCAATT
    ACAGGTTATCTTTTGCGTAGGTATGTAGATCCAAACTTAGTTTATGGGTTAGTGAGTGCG
    TGGGCGAGTGTATGCAAACCACCTATTAATCAAAGTGAAGTAAATAATACTTTTAAAAGT
    ATTTTGAAAAAAGATAGTAAAAACAGTTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    870

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0896 [new locus tag: SACOL_RS04600 ]
  • symbol: SACOL0896
  • description: pathogenicity island protein
  • length: 289
  • theoretical pI: 9.5494
  • theoretical MW: 33332.5
  • GRAVY: -0.570934

Function[edit | edit source]

  • TIGRFAM:
    DNA ligase D, polymerase domain (TIGR02778; HMM-score: 15)
    and 1 more
    Cellular processes Cellular processes Chemotaxis and motility flagellar biosynthetic protein FlhB (TIGR00328; HMM-score: 10.9)
  • TheSEED:  
    Phages, Prophages, Transposable elements, Plasmids Pathogenicity islands Staphylococcal pathogenicity islands SaPI  Hypothetical SAV0790 homolog in superantigen-encoding pathogenicity islands SaPI
  • PFAM:
    no clan defined PriCT_1; Primase C terminal 1 (PriCT-1) (PF08708; HMM-score: 46.3)
    and 1 more
    DMT (CL0184) DMT_6; Putative member of DMT superfamily (DUF486) (PF04342; HMM-score: 12.1)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.008802
    • TAT(Tat/SPI): 0.001297
    • LIPO(Sec/SPII): 0.000912
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MNEIKLKYDTQVSVVHYESLDSRSFKSFSMPKWSKLVNKLSVPIEANYKYARGVAVYGDIKDNTNDHGEIIKKHRNDKNVIYRNVIVLDYDEINDVKQLHDAISSVLSSVAWYWHTSFSHTTEQARIRLYIPLNERISADDYRKYTKVLANKIGHKVDEGSYQPSRCFALPVIQKGHIFIKRVNDCPIMDVDMLEQWSKEYKQSNGSPNIKGYTRRDSAYWRDIAFGVSEGERNSTLASITGYLLRRYVDPNLVYGLVSAWASVCKPPINQSEVNNTFKSILKKDSKNS

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]