Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0903 [new locus tag: SACOL_RS04635 ]
- pan locus tag?: SAUPAN002865000
- symbol: SACOL0903
- pan gene symbol?: —
- synonym:
- product: pathogenicity island protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0903 [new locus tag: SACOL_RS04635 ]
- symbol: SACOL0903
- product: pathogenicity island protein
- replicon: chromosome
- strand: +
- coordinates: 914464..914682
- length: 219
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 3237771 NCBI
- RefSeq: YP_185774 NCBI
- BioCyc:
- MicrobesOnline: 912374 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGGAAACAAAATGCGAGTTAAATAATACTAAAAAGGTCGCAAATGCATTTGGTTTAAAT
GAAGAAGATACAAATCTATTAATAAATGCAGTTGATTTGGATATTAAAAACAATATGCAG
GAGATTTCAAGTGAGTTACAACAATCAGAACAGTCTAAGCAAAAGCAATTAGGTACAACG
CTACAAAATTTAGCTAAGCAAAACAGGATTATTAAATAG60
120
180
219
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0903 [new locus tag: SACOL_RS04635 ]
- symbol: SACOL0903
- description: pathogenicity island protein
- length: 72
- theoretical pI: 5.01941
- theoretical MW: 8162.16
- GRAVY: -0.830556
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM: no clan defined SAPIS-gp6; Pathogenicity island protein gp6 in Staphylococcus (PF16722; HMM-score: 130.6)and 2 moreNifQ; NifQ (PF04891; HMM-score: 13.4)His_Kinase_A (CL0025) HisKA_2; Histidine kinase (PF07568; HMM-score: 12.9)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003907
- TAT(Tat/SPI): 0.000192
- LIPO(Sec/SPII): 0.000587
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- METKCELNNTKKVANAFGLNEEDTNLLINAVDLDIKNNMQEISSELQQSEQSKQKQLGTTLQNLAKQNRIIK
⊟Experimental data[edit | edit source]
- experimentally validated: no data available
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]