From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0903 [new locus tag: SACOL_RS04635 ]
  • pan locus tag?: SAUPAN002865000
  • symbol: SACOL0903
  • pan gene symbol?:
  • synonym:
  • product: pathogenicity island protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0903 [new locus tag: SACOL_RS04635 ]
  • symbol: SACOL0903
  • product: pathogenicity island protein
  • replicon: chromosome
  • strand: +
  • coordinates: 914464..914682
  • length: 219
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGGAAACAAAATGCGAGTTAAATAATACTAAAAAGGTCGCAAATGCATTTGGTTTAAAT
    GAAGAAGATACAAATCTATTAATAAATGCAGTTGATTTGGATATTAAAAACAATATGCAG
    GAGATTTCAAGTGAGTTACAACAATCAGAACAGTCTAAGCAAAAGCAATTAGGTACAACG
    CTACAAAATTTAGCTAAGCAAAACAGGATTATTAAATAG
    60
    120
    180
    219


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0903 [new locus tag: SACOL_RS04635 ]
  • symbol: SACOL0903
  • description: pathogenicity island protein
  • length: 72
  • theoretical pI: 5.01941
  • theoretical MW: 8162.16
  • GRAVY: -0.830556

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Hypothetical SAV0797 homolog in superantigen-encoding pathogenicity islands SaPI
    Phages, Prophages, Transposable elements, Plasmids Pathogenicity islands Staphylococcal pathogenicity islands SaPI  Hypothetical SAV0797 homolog in superantigen-encoding pathogenicity islands SaPI
  • PFAM:
    no clan defined SAPIS-gp6; Pathogenicity island protein gp6 in Staphylococcus (PF16722; HMM-score: 131.9)
    and 3 more
    NifQ; NifQ (PF04891; HMM-score: 14)
    His_Kinase_A (CL0025) HisKA_2; Histidine kinase (PF07568; HMM-score: 12.8)
    HTH (CL0123) DUF5805; Family of unknown function (DUF5805) (PF19121; HMM-score: 11.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.5849
    • Cytoplasmic Membrane Score: 0.0018
    • Cell wall & surface Score: 0.0004
    • Extracellular Score: 0.4129
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003907
    • TAT(Tat/SPI): 0.000192
    • LIPO(Sec/SPII): 0.000587
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • METKCELNNTKKVANAFGLNEEDTNLLINAVDLDIKNNMQEISSELQQSEQSKQKQLGTTLQNLAKQNRIIK

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]